Breakfast
Freeflourish
Gluten-Free Savory Herb and Cheese Palmiers
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 23, 2026 · Updated Jul 7, 2026
French-inspired
35 mins
glutenfreevegetarianbakingsnackfamilyfriendlyeasyappetizerkidfriendlysavory
These easy-to-make gluten-free savory palmiers combine fresh herbs and sharp cheddar cheese in a flaky, crispy puff pastry, ideal as a snack, appetizer, or kid-friendly treat. A perfect family-friendly recipe for quick baking and gluten-free snacking any time of day.
Prep
15 min
Cook
20 min
Total
35 min
Servings
24
Difficulty
easy
Cuisine
French-inspired
Ingredients
Servings
24
- 1 sheet gluten-free puff pastry (about 8 oz), thawed
- 1 cup shredded sharp cheddar cheese (or dairy-free cheese for dairy-free options)
- 2 tablespoons fresh parsley, finely chopped
- 1 tablespoon fresh thyme leaves, finely chopped
- 1 teaspoon garlic powder
- 1/4 teaspoon salt
- 1/4 teaspoon black pepper
- 1 large egg (for egg wash) or dairy-free milk alternative for brushing
Instructions
-
Preheat your oven to 400 degrees F. Line a baking sheet with parchment paper.
-
Unfold the thawed gluten-free puff pastry sheet on a lightly floured surface using gluten-free flour.
-
Sprinkle the shredded cheese evenly over the entire surface of the pastry sheet.
-
Evenly distribute the chopped parsley, thyme, garlic powder, salt, and pepper over the cheese layer.
-
Starting from one edge, carefully roll the pastry tightly towards the center to form a log. Repeat from the opposite edge, rolling towards the center so both sides meet in the middle.
-
Wrap the rolled log tightly in plastic wrap and refrigerate for about 10 minutes to firm up.
-
Remove the log from the fridge and slice into approximately 1/4-inch (0.6 cm) thick slices to create individual palmiers.
-
Place the palmiers on the prepared baking sheet spaced about 1 inch apart.
-
Brush the tops lightly with beaten egg or a dairy-free milk alternative for a golden finish.
-
Bake in the preheated oven for 18 to 20 minutes, or until the palmiers are puffed, golden, and crisp.
-
Allow the palmiers to cool for 5 minutes before serving warm or at room temperature.
Tips
Allergen Overlap Note
Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces, dedicated utensils, and fresh parchment or cookware when preparing savory herb and cheese palmiers for someone with celiac disease.
Texture Expectations
Roll tightly and chill briefly before slicing so the layers hold shape and puff cleanly.
Dining With Non-GF Family Note
Serve these in child-safe pieces and keep separate serving bowls when mixed-diet friends are sharing a snack table.
Frequently Asked Questions
- Can I make Gluten-Free Savory Herb and Cheese Palmiers ahead?
- Yes. Prepare the components ahead when practical, then store and reheat according to the storage guidance so the texture stays close to fresh.
- How do I keep this recipe gluten-free?
- Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
- Can I adjust the main ingredients?
- Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.
- What is the best way to serve it with mixed-diet family?
- Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.
Ingredient Replacements
- main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- garnish: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Storage and Reheating
Store cooled palmiers in an airtight container for up to 4 days. Reheat in a 325 degrees F oven briefly to regain crispness.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register