Freeflourish

Snacks

Gluten-Free Savory Black Garlic and Herb Polenta Fries

By Freeflourish Editorial TeamPublished Apr 22, 2026 | Updated Jul 7, 2026
Italian-inspired 40 mins glutenfreedairyfreegrainfreefamilyfriendlysnackeasyappetizerkidfriendlysidedish

Gluten-Free Savory Black Garlic and Herb Polenta Fries with measured ingredients, 40-minute timing, 4-serving yield, and step-by-step instructions for gluten-free meals, baking, snacks, and desserts.

Gluten-Free Savory Black Garlic and Herb Polenta Fries
Prep 15 min
Cook 25 min
Total 40 min
Servings 4
Difficulty easy
Cuisine Italian-inspired

Recipe Details

Prep15 min
Cook25 min
Total40 min
Servings4
Difficultyeasy
CuisineItalian-inspired
Add To Favorites

Ingredients

Servings 4
  • 1 cup yellow cornmeal (gluten-free)
  • 4 cups water
  • 1 teaspoon salt, divided
  • 2 tablespoons olive oil, plus extra for frying
  • 4 cloves black garlic, minced
  • 1 tablespoon fresh rosemary, finely chopped
  • 1 tablespoon fresh thyme leaves
  • 1/2 teaspoon freshly ground black pepper
  • 1/4 teaspoon smoked paprika (optional)
  • Fresh parsley, chopped (for garnish)
FreeFlourish gluten-free savory black garlic herb polenta fries ingredients
FreeFlourish gluten-free savory black garlic herb polenta fries ingredients

Instructions

  1. In a medium saucepan, bring 4 cups of water and 1/2 teaspoon salt to a gentle boil over medium heat.
  2. Slowly whisk in the gluten-free yellow cornmeal, stirring constantly to prevent lumps.
  3. Reduce heat to low and stir the polenta continuously for 10-12 minutes until thick and creamy.
  4. Remove from heat and mix in 2 tablespoons olive oil, minced black garlic, rosemary, thyme, black pepper, and smoked paprika if using.
  5. Pour the polenta into a greased 9x9-inch baking dish and smooth the top evenly.
  6. Allow the polenta to cool and set at room temperature for 30 minutes, or refrigerate for 15 minutes to firm up faster.
  7. Once firm, invert the polenta onto a cutting board and slice into 1/2-inch thick fry shapes.
  8. Heat a generous amount of olive oil in a large non-stick skillet over medium heat.
  9. Fry the polenta fries in batches without crowding the pan, cooking each side 3-4 minutes until golden brown and crispy.
  10. Transfer fries to paper towels to drain excess oil.
  11. Serve warm, garnished with fresh parsley. Pair with your favorite dairy-free dipping sauce or marinara if desired.
  12. Enjoy these savory, gluten-free black garlic and herb polenta fries as a quick, healthy snack, kid-friendly appetizer, or satisfying side dish for family meals.
FreeFlourish savory black garlic herb polenta fries finished dish
FreeFlourish savory black garlic herb polenta fries finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces, dedicated utensils, and fresh parchment or cookware when preparing savory black garlic herb polenta fries for someone with celiac disease.

Texture Expectations

Let the polenta set fully before slicing so each fry keeps shape, then keep frying batches separated so edges crisp while centers stay soft.

Dining With Non-GF Family Note

Serve as a shared appetizer tray on a dedicated gluten-free surface and keep non-GF fried foods separate if serving mixed-diet snacks.

Frequently Asked Questions

Can I make Gluten-Free Savory Black Garlic and Herb Polenta Fries ahead?
Yes. Prepare the components ahead when practical, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?
Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?
Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.
What is the best way to serve it with mixed-diet family?
Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.

Storage and Reheating

Store cooled fries in an airtight container up to 2 days. Reheat briefly in a hot pan to recover crispness.

Related Articles

Read related guides and practical cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.