How do I keep this recipe gluten-free?

Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.

Can I adjust the main ingredients?

Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.

How do I serve it with mixed-diet family?

Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Back to Recipes

Snacks

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites

Name: Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites
Prep time: 20 min
Cook time: 25 min
Total time: 45 min
Yield: 12 servings
Cuisine: British-inspired
Ingredients: 1 package (about 14 oz) gluten-free puff pastry sheets, thawed; 1 tablespoon olive oil; 1 small onion, finely chopped; 3 cloves garlic, minced; 8 oz cremini or white mushrooms, finely chopped; 4 cups fresh spinach, chopped; 1/3 cup finely chopped walnuts (optional - omit for nut-free) - for nut-free version, replace with 1/3 cup cooked lentils; 1 tablespoon gluten-free tamari or soy sauce; 1 teaspoon dried thyme; 1/2 teaspoon smoked paprika; Salt and freshly ground black pepper, to taste; 1 tablespoon ground flaxseed + 3 tablespoons water (flax egg for egg wash replacement); 1 teaspoon lemon juice

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 7, 2026 · Updated Jul 7, 2026

British-inspired 45 mins glutenfreevegandairyfreenutfreefamilyfriendlysnackeasyappetizerholidayclassicfreezablequickrecipesbaking

Delicious gluten-free, vegan, dairy-free, and nut-free Wellington bites with a savory spinach, mushroom, and walnut filling wrapped in flaky gluten-free pastry. These family-friendly snacks are ideal for holiday & seasonal gatherings, quick & easy meals, and comforting finger foods that everyone will love.

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites

Prep 20 min

Cook 25 min

Total 45 min

Servings 12

Difficulty easy

Cuisine British-inspired

Ingredients

Servings 12

1 package (about 14 oz) gluten-free puff pastry sheets, thawed
1 tablespoon olive oil
1 small onion, finely chopped
3 cloves garlic, minced
8 oz cremini or white mushrooms, finely chopped
4 cups fresh spinach, chopped
1/3 cup finely chopped walnuts (optional - omit for nut-free) - for nut-free version, replace with 1/3 cup cooked lentils
1 tablespoon gluten-free tamari or soy sauce
1 teaspoon dried thyme
1/2 teaspoon smoked paprika
Salt and freshly ground black pepper, to taste
1 tablespoon ground flaxseed + 3 tablespoons water (flax egg for egg wash replacement)
1 teaspoon lemon juice

FreeFlourish Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites ingredients

Instructions

Preheat oven to 400 degrees F. Line a baking sheet with parchment paper.
In a small bowl, combine ground flaxseed and water. Stir well and set aside to thicken (about 5 minutes). This will be your egg wash substitute.
Heat olive oil in a large skillet over medium heat. Add the chopped onion and sauté until translucent, about 3-4 minutes.
Add the minced garlic and cook for 1 minute until fragrant.
Add the finely chopped mushrooms and cook until they release their moisture and it evaporates, about 7-8 minutes.
Stir in the chopped spinach and cook until wilted, about 2 minutes.
Add the walnuts (or lentils for nut-free), tamari, dried thyme, smoked paprika, lemon juice, salt, and pepper. Mix well and cook an additional 2 minutes, then remove from heat and let filling cool.
On a lightly floured surface (using gluten-free flour), roll out the puff pastry sheets to smooth out creases and slightly enlarge the sheets.
Cut the pastry into 12 equal squares.
Place a heaping tablespoon of the cooled filling onto the center of each square.
Brush the edges of each pastry square lightly with the flax egg mixture.
Fold each corner of the square toward the center to cover the filling, pinching edges gently to seal. You can fold opposite corners to form a neat parcel or slightly twist the tops for a decorative look.
Place the formed bites onto the prepared baking sheet, seam side down.
Brush the tops lightly with the remaining flax egg mixture for a golden finish.
Bake in the preheated oven for 20-25 minutes until pastry is golden and puffed.
Remove from oven and allow to cool slightly before serving.
Serve warm or at room temperature. These Wellington bites freeze well - freeze uncooked bites on a tray, then transfer to a sealed container for up to 3 months. Bake from frozen, adding a few extra minutes to baking time.

FreeFlourish Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites for someone with celiac disease.

Texture Expectations

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites should keep the intended servings texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites ahead?: Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?: Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?: Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?: Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Ingredient Replacements

Salt and freshly ground black pepper: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
+ 3 tablespoons water: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites

Recipe Details

Ingredients

Instructions