Freeflourish
Back to Recipes

Snacks

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 7, 2026 · Updated May 11, 2026
British-inspired 45 mins glutenfreevegandairyfreenutfreefamilyfriendlysnackeasyappetizerholidayclassicfreezablequickrecipesbaking

Delicious gluten-free, vegan, dairy-free, and nut-free Wellington bites with a savory spinach, mushroom, and walnut filling wrapped in flaky gluten-free pastry. These family-friendly snacks are ideal for holiday & seasonal gatherings, quick & easy meals, and comforting finger foods that everyone will love.

Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites
Prep 20 min
Cook 25 min
Total 45 min
Servings 12
Difficulty easy
Cuisine British-inspired

Recipe Details

Prep20 min
Cook25 min
Total45 min
Servings12
Difficultyeasy
CuisineBritish-inspired
Add To Favorites

Ingredients

Servings 12
  • 1 package (about 14 oz) gluten-free puff pastry sheets, thawed
  • 1 tablespoon olive oil
  • 1 small onion, finely chopped
  • 3 cloves garlic, minced
  • 8 oz cremini or white mushrooms, finely chopped
  • 4 cups fresh spinach, chopped
  • 1/3 cup finely chopped walnuts (optional - omit for nut-free) - for nut-free version, replace with 1/3 cup cooked lentils
  • 1 tablespoon gluten-free tamari or soy sauce
  • 1 teaspoon dried thyme
  • 1/2 teaspoon smoked paprika
  • Salt and freshly ground black pepper, to taste
  • 1 tablespoon ground flaxseed + 3 tablespoons water (flax egg for egg wash replacement)
  • 1 teaspoon lemon juice

Instructions

  1. Preheat oven to 400°F (200°C). Line a baking sheet with parchment paper.
  2. In a small bowl, combine ground flaxseed and water. Stir well and set aside to thicken (about 5 minutes). This will be your egg wash substitute.
  3. Heat olive oil in a large skillet over medium heat. Add the chopped onion and sauté until translucent, about 3-4 minutes.
  4. Add the minced garlic and cook for 1 minute until fragrant.
  5. Add the finely chopped mushrooms and cook until they release their moisture and it evaporates, about 7-8 minutes.
  6. Stir in the chopped spinach and cook until wilted, about 2 minutes.
  7. Add the walnuts (or lentils for nut-free), tamari, dried thyme, smoked paprika, lemon juice, salt, and pepper. Mix well and cook an additional 2 minutes, then remove from heat and let filling cool.
  8. On a lightly floured surface (using gluten-free flour), roll out the puff pastry sheets to smooth out creases and slightly enlarge the sheets.
  9. Cut the pastry into 12 equal squares.
  10. Place a heaping tablespoon of the cooled filling onto the center of each square.
  11. Brush the edges of each pastry square lightly with the flax egg mixture.
  12. Fold each corner of the square toward the center to cover the filling, pinching edges gently to seal. You can fold opposite corners to form a neat parcel or slightly twist the tops for a decorative look.
  13. Place the formed bites onto the prepared baking sheet, seam side down.
  14. Brush the tops lightly with the remaining flax egg mixture for a golden finish.
  15. Bake in the preheated oven for 20-25 minutes until pastry is golden and puffed.
  16. Remove from oven and allow to cool slightly before serving.
  17. Serve warm or at room temperature. These Wellington bites freeze well — freeze uncooked bites on a tray, then transfer to a sealed container for up to 3 months. Bake from frozen, adding a few extra minutes to baking time.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

For this Gluten-Free Vegan Spinach, Mushroom, and Walnut Wellington Bites recipe, here are some helpful ingredient substitutions to suit various dietary needs and preferences:

  • Walnuts: To keep the recipe nut-free, omit the walnuts and replace with an equal amount (about 1/3 cup) of cooked lentils. This preserves texture and adds protein.
  • Pastry: Use certified gluten-free puff pastry sheets to ensure the bites are gluten-free. Verify that the brand is also dairy-free if needed.
  • Flax Egg (Egg Wash Substitute): Ground flaxseed mixed with water works well as a vegan and dairy-free egg wash. Aquafaba (chickpea water) can be used as an alternative.
  • Tamari: Opt for gluten-free tamari to keep it gluten-free. For a soy-free option, substitute with coconut aminos.
  • Mushrooms and Spinach: Fresh mushrooms and spinach provide optimal flavor and texture. You can substitute kale or Swiss chard if preferred.

These substitutions make it easy to tailor the recipe for gluten-free, vegan, dairy-free, nut-free, paleo, or whole30 diets without sacrificing taste or texture.

Allergen Overlap Note

While these gluten-free recipes are crafted to avoid gluten-containing ingredients, please be aware that cross-contamination can occur if shared equipment or surfaces have been in contact with gluten, nuts, dairy, or other allergens. Many recipes in our categories—including Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, and Gluten-Free Baking—also cater to dairy-free, nut-free, vegan, and other special diets. However, if you have severe allergies or sensitivities, we recommend strict care when selecting ingredients, thoroughly cleaning preparation areas, and using dedicated utensils and cookware to minimize risk.

Recipes tagged glutenfree and related labels such as dairyfree, nutfree, vegan, and vegetarian are designed with allergen safety in mind, but please verify each ingredient’s sourcing and processing to ensure it meets your needs. Substitutions like replacing nuts with lentils or alternative flours may be suggested for greater safety and inclusivity.

For family-friendly, holiday & seasonal, or quick & easy meals across our diverse categories, maintaining clean preparation practices and carefully reading packaging labels will help you enjoy comforting, delicious, and safe meals every time.

Texture Expectations

Gluten-free recipes, especially those featuring puff pastry like these Wellington bites, often have a slightly different texture profile compared to traditional wheat-based versions. The gluten-free pastry here achieves a delicately flaky and golden crust that is tender yet crisp, striking a satisfying balance without becoming overly dense or gummy.

The filling combines sautéed mushrooms and spinach with walnuts or lentils for nut-free versions, delivering a moist, slightly chunky interior with occasional contrasting crunch from the walnuts. This blend provides delightful textural variety—offering soft, wilted greens mingled with hearty mushrooms and the nutty bite or lentil earthiness. The flaxseed "egg wash" lends a subtle coating that helps the pastry seal flawlessly and develop a beautifully browned, slightly glossy finish.

Because gluten-free flours and doughs lack gluten’s elastic structure, the pastry may be more delicate and prone to slight crumbling, but careful handling and chilling before baking help it puff up well and hold together. Expect a tender, melt-in-your-mouth crust that pairs perfectly with the luscious, savory filling. Serving these bites warm unlocks the best textural contrast — crisp pastry encasing a warm, flavorful filling.

Variations such as swapping walnuts for lentils or using different greens will subtly impact moisture content and mouthfeel, but the overall experience remains a harmonious blend of flaky exterior and rich, savory center. For best texture results, avoid overfilling to prevent sogginess, and bake until golden to maintain crispness. These bites also freeze well, with a slight textural shift upon reheating, retaining delicious flakiness and moist filling.

Dining With Non Gf Family Note

Preparing gluten-free meals in a household that also consumes gluten can be a smooth and enjoyable experience with some mindful practices to prevent cross-contamination. Here are some practical tips to ensure everyone enjoys breakfast, lunch, dinner, snacks, desserts, soups & salads, and more without worry:

  • Separate Cooking Areas and Utensils: Designate specific areas, cutting boards, and utensils for gluten-free meal prep to avoid accidental contact with gluten-containing ingredients.
  • Clean Thoroughly: Always wash hands, surfaces, and cookware thoroughly before starting gluten-free preparations. Consider using separate sponges or cloths for gluten-free cooking zones.
  • Store Ingredients Separately: Keep gluten-free flours, baking mixes, and other staples clearly labeled and stored apart from regular products to prevent mix-ups.
  • Read Labels Carefully: Even common ingredients can hide gluten. Check all packaging for glutenfree assurance, especially when buying items tagged for glutenfree, dairyfreeoptions, nutfree, paleo, or whole30 diets.
  • Use Dedicated Appliances or Line Them: Toaster ovens or baking sheets should be gluten-free or lined with parchment paper to safeguard your meal prep.
  • Communicate Clearly: Especially with family-friendly, quick & easy, or holiday & seasonal meals, involve all members in understanding the importance of gluten-free safety and what foods are safe to share.
  • Serve Separately: For dishes like bread, desserts, or snacks, offer gluten-free versions alongside non-gluten-free options to keep cross-contact minimal while allowing everyone to enjoy.
  • Plan for Meal Prep and Storage: Many gluten-free recipes, such as freezable, onepot, or budgetfriendly meals, can be made ahead and kept distinct from gluten-containing dishes.

By following these guidelines, you can confidently provide safe and delicious gluten-free meals throughout your family's diverse dining needs, ensuring comfort and inclusion at every meal.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.