Freeflourish
Back to Recipes

Snacks

Gluten-Free Savory Chickpea and Spinach Tarts with Cashew Cream

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 13, 2026 · Updated May 11, 2026
Mediterranean-inspired 45 mins glutenfreevegetariandairyfreeoptionsbakingfamilyfriendlyeasysidedishappetizerquickrecipescomfortfoodholidayclassicseasonal

These gluten-free savory chickpea and spinach tarts combine a smooth dairy-free cashew cream with sautéed spinach and protein-rich chickpeas in a flaky gluten-free crust. Inspired by Mediterranean flavors, they're a family-friendly, quick & easy recipe perfect as an appetizer, side dish, snack, or light meal for breakfast, lunch, or dinner.

Gluten-Free Savory Chickpea and Spinach Tarts with Cashew Cream
Prep 15 min
Cook 30 min
Total 45 min
Servings 6
Difficulty easy
Cuisine Mediterranean-inspired

Recipe Details

Prep15 min
Cook30 min
Total45 min
Servings6
Difficultyeasy
CuisineMediterranean-inspired
Add To Favorites

Ingredients

Servings 6
  • 1 1/2 cups gluten-free all-purpose flour blend (ensure xanthan gum included)
  • 1/2 teaspoon salt
  • 1/2 teaspoon garlic powder
  • 1/4 teaspoon dried oregano
  • 1/4 teaspoon baking powder
  • 1/2 cup cold vegan butter or coconut oil, cubed
  • 3 to 4 tablespoons ice cold water
  • 1 cup raw cashews, soaked in warm water for 2 hours then drained
  • 1/2 cup water
  • 2 tablespoons nutritional yeast
  • 2 tablespoons fresh lemon juice
  • 1 teaspoon garlic powder
  • 1/2 teaspoon salt
  • 1/4 teaspoon black pepper
  • 1 tablespoon olive oil
  • 1 small yellow onion, finely chopped
  • 3 cloves garlic, minced
  • 5 cups fresh spinach, roughly chopped
  • 1 1/2 cups cooked chickpeas (or canned, rinsed and drained)
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Fresh parsley or oregano leaves for garnish

Instructions

  1. Preheat the oven to 375°F (190°C). Lightly grease a 6-cup muffin tin or line with parchment paper liners.
  2. In a large mixing bowl, whisk together the gluten-free flour, salt, garlic powder, oregano, and baking powder.
  3. Add the cold vegan butter or coconut oil cubes. Using a pastry cutter or your fingers, cut or rub the fat into the flour mixture until it resembles coarse crumbs.
  4. Gradually add 3 tablespoons of ice-cold water, stirring until the dough starts to come together. Add a little more water if needed, 1 teaspoon at a time, until the dough forms a ball.
  5. Wrap the dough in plastic wrap and chill in the refrigerator for 15 minutes while preparing the filling.
  6. To prepare the cashew cream, combine the soaked and drained cashews, water, nutritional yeast, lemon juice, garlic powder, salt, and pepper in a high-speed blender. Blend until completely smooth and creamy. Set aside.
  7. Heat olive oil in a large skillet over medium heat. Add the chopped onion and sauté until translucent, about 5 minutes.
  8. Add minced garlic and cook for 1 minute until fragrant.
  9. Add chopped spinach and cook until wilted, about 3-4 minutes.
  10. Stir in the cooked chickpeas and crushed red pepper flakes (if using). Cook for another 2 minutes, then remove from heat and let cool slightly.
  11. Fold half of the cashew cream into the spinach and chickpea mixture until combined.
  12. Remove the dough from the fridge and divide it into 6 equal portions.
  13. On a lightly floured surface with gluten-free flour, roll each portion into a circle about 5 inches in diameter.
  14. Press each dough circle gently into the muffin tin cups, forming a small tart shell with sides.
  15. Evenly spoon the spinach and chickpea filling into each tart shell.
  16. Top each with a tablespoon of the remaining cashew cream and spread lightly.
  17. Bake for 25 to 30 minutes, or until the crust is golden and the filling is set.
  18. Remove from oven and allow to cool for 5 minutes before carefully removing from the tin.
  19. Garnish with fresh parsley or oregano leaves and serve warm or at room temperature.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

To suit various dietary preferences while enjoying these gluten-free savory chickpea and spinach tarts with cashew cream, consider these ingredient substitutions:

  • Gluten-Free: This recipe uses a gluten-free all-purpose flour blend with xanthan gum. Feel free to substitute with your trusted gluten-free flour blend.
  • Dairy-Free: The recipe is naturally dairy-free using vegan butter or coconut oil and cashew cream; maintain dairy-free status by avoiding dairy additions.
  • Nut-Free: Replace cashew cream with sunflower seed cream or silken tofu blended with nutritional yeast, lemon juice, and seasonings for a nut-free creamy alternative.
  • Vegan: Confirm that vegan butter or oils used are certified vegan to maintain this designation.
  • Low-Carb: Use almond and coconut flour blends for the crust, swapping chickpeas with lower-carb vegetables like green beans or zucchini.
  • High Protein: Boost protein by adding cooked quinoa, hemp seeds to the filling, or mixing pea protein powder into the cashew cream.
  • Paleo & Whole30: Opt for almond or cassava flour crusts, omit nutritional yeast, and substitute cashew cream with macadamia nut or coconut cream alternatives.
  • Kid-Friendly: Omit crushed red pepper flakes and reduce garlic to suit young palates.

These adaptations keep the Mediterranean-inspired taste and comforting textures intact while catering to diverse dietary needs.

Allergen Overlap Note

While our gluten-free recipes are carefully crafted to exclude gluten-containing ingredients, cross-contamination risks can still exist, especially in shared kitchen environments or with processed ingredients. If you have celiac disease or severe gluten intolerance, we recommend the following precautions:

  • Use certified gluten-free flours and baking mixes to ensure safety.
  • Thoroughly clean all utensils, cutting boards, and surfaces to avoid gluten residue.
  • Avoid using shared equipment that may have contact with gluten-containing foods.
  • Check labels for potential allergens and hidden gluten, particularly in processed ingredients such as nutritional yeast or seasonings.

Additionally, many gluten-free recipes on Freeflourish also accommodate other common allergens like dairy and nuts, but individual ingredient checks are important to ensure safety. For family-friendly, quick, and holiday or seasonal recipes, always verify the specific recipe tags such as dairyfreeoptions, nutfree, and vegan to meet your dietary needs.

By following safe cooking practices and ingredient verification, you can confidently enjoy our diverse freezer-friendly, comfort food, and gluten-free baking recipes across breakfast, lunch, dinner, snacks, desserts, soups, and salads.

Texture Expectations

When enjoying these gluten-free savory chickpea and spinach tarts, expect a delightful contrast of textures that showcase the best of gluten-free baking and wholesome Mediterranean-inspired fillings. The crust, crafted from a gluten-free all-purpose flour blend with vegan butter or coconut oil, offers a tender, flaky shell that holds its shape without crumbling, thanks to xanthan gum. While distinct from traditional wheat crusts, it delivers a satisfying buttery crispness and gentle crumble with every bite.

The creamy cashew filling provides a smooth, velvety texture that enriches the hearty chickpeas and tender sautéed spinach. The chickpeas add a soft, substantial bite while the spinach contributes gentle moisture and softness, balancing the overall mouthfeel. These layers together create a creamy yet substantial filling that pairs beautifully with the flaky crust.

Once slightly cooled, the tarts slice easily and maintain structure, making them ideal as appetizers, quick snacks, or light meals. Variations in gluten-free flours or fat types (vegan butter vs. coconut oil) may subtly influence flakiness and tenderness, but the texture remains warmly inviting and family-friendly.

Gluten-free baked goods often improve after a brief resting period to let moisture redistribute; these tarts are delicious served warm or at room temperature and are freezable for convenient meal prep. Enjoy the comforting combination of delightful textures and healthy Mediterranean flavors with every bite.

Dining With Non Gf Family Note

Preparing gluten-free meals in a household with non-gluten-free members can be both rewarding and challenging. To ensure everyone enjoys delicious and safe meals—whether breakfast, lunch, dinner, snacks, or desserts—follow these key tips for coexistence and cross-contamination prevention:

  • Separate Cooking Areas and Tools: Dedicate specific utensils, cutting boards, mixing bowls, and pans for gluten-free cooking. Avoid using the same surfaces or tools for gluten-free and gluten-containing foods without thorough cleaning.
  • Clean Thoroughly: Wash hands, counters, and cooking equipment meticulously before preparing gluten-free dishes to remove any residual gluten.
  • Store Gluten-Free Ingredients Separately: Keep gluten-free flours, snacks, and baking ingredients in clearly labeled, sealed containers away from gluten-containing products to avoid accidental mixing.
  • Use Gluten-Free Baking and Cooking Products: Choose certified gluten-free flours and baking mixes, especially for recipes like gluten-free baking or holiday classics, to maintain quality and safety.
  • Educate Family Members: Make sure everyone understands the importance of avoiding cross-contact to support those with gluten sensitivity or celiac disease.
  • Plan Family-Friendly, Quick & Easy Meals: Select recipes that naturally accommodate gluten-free preparation alongside other preferences, such as dishes marked "familyfriendly," "easy," or "30minutesorless," making mealtime enjoyable for all.
  • Label Foods Clearly: When serving buffet-style or sharing meals, indicate which dishes are gluten-free so family members can easily identify safe options.
  • Consider One-Pot or Freezable Recipes: These simplify meal prep and reduce the risk of cross-contamination by minimizing the number of cookware pieces used.

With mindful practices, it’s possible to create flavorful, comforting meals across all categories—from soups & salads and main courses to gluten-free baking and snacks—that everyone can enjoy together safely.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.