Breakfast
Freeflourish
Gluten-Free Quick & Easy Savory Chickpea and Carrot Biscuits
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 1, 2026 · Updated May 11, 2026
American-inspired
25 mins
glutenfreevegandairyfreenutfreeeasyquickrecipessidedishfamilyfriendlybudgetfriendly30minutesorlesssavorybaking
Quick and easy gluten-free, vegan savory biscuits made with chickpeas and grated carrots. A wholesome, allergy-friendly side dish or snack ideal for family meals, budget cooking, and quick recipes under 30 minutes.
Prep
10 min
Cook
15 min
Total
25 min
Servings
8
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
8
- 1 1/2 cups canned chickpeas, drained and patted dry
- 1 cup finely grated carrot (about 1 large carrot)
- 1 3/4 cups gluten-free all-purpose flour blend (ensure it contains xanthan gum)
- 1 tablespoon gluten-free baking powder
- 1/2 teaspoon baking soda
- 1/2 teaspoon salt
- 1 teaspoon garlic powder
- 1 teaspoon onion powder
- 1/2 teaspoon dried thyme or rosemary (optional)
- 3/4 cup unsweetened plain almond milk or other plant-based milk
- 2 tablespoons olive oil or melted coconut oil
- 1 tablespoon apple cider vinegar
Instructions
-
Preheat oven to 425°F (220°C) and line a baking sheet with parchment paper.
-
Pulse chickpeas in a food processor 6-8 times until broken down but still slightly chunky.
-
In a large bowl, whisk together gluten-free flour, baking powder, baking soda, salt, garlic powder, onion powder, and dried herbs if using.
-
Add grated carrot to the dry ingredients and toss to coat evenly.
-
In a small bowl, whisk plant-based milk, olive oil, and apple cider vinegar.
-
Add chickpeas and wet ingredients to the dry mixture. Stir gently until just combined into a soft, slightly sticky dough. Avoid overmixing.
-
Turn dough onto lightly floured surface and pat into a 1-inch thick rectangle.
-
Cut biscuits using a 2.5-inch cutter and place on baking sheet about 1 inch apart.
-
Press leftover dough scraps together and cut additional biscuits until dough is used.
-
Bake 12-15 minutes until golden and biscuits spring back when pressed.
-
Cool slightly before serving warm.
-
Serve as a flavorful gluten-free side with soups, salads, or vegan spreads.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
This recipe is naturally gluten-free, vegan, dairy-free, and nut-free, making it ideal for many dietary needs. Some ingredient swaps that preserve nutrition and taste include:
- Chickpeas: Swap for white beans or cannellini beans to vary texture but keep protein.
- Gluten-Free Flour: Use your go-to all-purpose gluten-free blend containing xanthan gum, or combine rice flour with tapioca starch for a different crumb.
- Plant-Based Milk: Substitute almond milk with unsweetened oat, soy, or rice milk. Soy milk provides extra protein; oat and rice milks are nut-free options.
- Oils: Replace olive or coconut oil with avocado or light vegetable oil; coconut oil adds slight sweetness, olive oil keeps it savory.
- Acidulent: Apple cider vinegar can be swapped with white vinegar or fresh lemon juice to activate leavening.
These replacements ensure your biscuits remain allergy-safe, quick, easy, and delicious.
Allergen Overlap Note
While these gluten-free recipes are designed to be allergy-friendly, always be mindful of cross-contamination risks in your kitchen and with packaged ingredients. Choose certified gluten-free flours and baking powders to maintain safety.
Recipes tagged dairyfree, nutfree, vegan, and vegetarian may still share preparation spaces with allergens like nuts, dairy, or soy. To minimize allergen overlap:
- Use separate gluten-free utensils and bakeware.
- Clean surfaces thoroughly before preparation.
- Check labels carefully for hidden gluten or allergens.
- Select ingredient substitutions that meet your dietary needs.
These best practices help ensure your gluten-free baked goods and snacks—whether quick sides, family meals, or holiday classics—are safe, healthy, and delicious.
Texture Expectations
Expect these gluten-free quick & easy savory chickpea and carrot biscuits to have a texture uniquely hearty yet soft compared to traditional biscuits. The gluten-free flour blend with xanthan gum provides structure, while chickpeas add a tender, slightly chunky protein boost.
The golden crust on the outside offers gentle crispness without brittleness, and grated carrots add moisture and a subtle natural sweetness that balances savory spices. The dairy-free, vegan formulation keeps the crumb moist and comforting rather than flaky or buttery.
Avoid overmixing to maintain lightness and an airy crumb. Overall, these biscuits deliver a wholesome, softly crumbly, and satisfying mouthfeel ideal for quick gluten-free baking, family-friendly meals, and savory snack options.
Dining With Non Gf Family Note
Preparing gluten-free meals that everyone in the family can enjoy is easier with some careful planning. To avoid cross-contamination when dining with gluten-eating family members, consider these tips:
- Use designated utensils and prep areas for gluten-free cooking and clean surfaces well to avoid gluten residue.
- Use separate appliances such as gluten-free toaster bags or dedicated toaster if possible.
- Store gluten-free ingredients separately from wheat-containing products.
- Read ingredient labels carefully for hidden gluten or allergens.
- Communicate dietary needs with family to encourage support.
- Cook gluten-free dishes first to reduce risk of contamination.
- Choose inclusive recipes from categories like Breakfast, Lunch, Dinner, and Snacks on Freeflourish, emphasizing tags like familyfriendly and easy.
Following these best practices, you can enjoy delicious, inclusive gluten-free meals alongside your whole family.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register