Breakfast
Freeflourish
Gluten-Free Quick & Easy Savory Chickpea and Carrot Biscuits
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 1, 2026 · Updated Jul 7, 2026
American-inspired
25 mins
glutenfreevegandairyfreenutfreeeasyquickrecipessidedishfamilyfriendlybudgetfriendly30minutesorlesssavorybaking
Quick and easy gluten-free, vegan savory biscuits made with chickpeas and grated carrots. A wholesome, allergy-friendly side dish or snack ideal for family meals, budget cooking, and quick recipes under 30 minutes.
Prep
10 min
Cook
15 min
Total
25 min
Servings
8
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
8
- 1 1/2 cups canned chickpeas, drained and patted dry
- 1 cup finely grated carrot (about 1 large carrot)
- 1 3/4 cups gluten-free all-purpose flour blend (ensure it contains xanthan gum)
- 1 tablespoon gluten-free baking powder
- 1/2 teaspoon baking soda
- 1/2 teaspoon salt
- 1 teaspoon garlic powder
- 1 teaspoon onion powder
- 1/2 teaspoon dried thyme or rosemary (optional)
- 3/4 cup unsweetened plain almond milk or other plant-based milk
- 2 tablespoons olive oil or melted coconut oil
- 1 tablespoon apple cider vinegar
Instructions
-
Preheat oven to 425 degrees F and line a baking sheet with parchment paper.
-
Pulse chickpeas in a food processor 6-8 times until broken down but still slightly chunky.
-
In a large bowl, whisk together gluten-free flour, baking powder, baking soda, salt, garlic powder, onion powder, and dried herbs if using.
-
Add grated carrot to the dry ingredients and toss to coat evenly.
-
In a small bowl, whisk plant-based milk, olive oil, and apple cider vinegar.
-
Add chickpeas and wet ingredients to the dry mixture. Stir gently until just combined into a soft, slightly sticky dough. Avoid overmixing.
-
Turn dough onto lightly floured surface and pat into a 1-inch thick rectangle.
-
Cut biscuits using a 2.5-inch cutter and place on baking sheet about 1 inch apart.
-
Press leftover dough scraps together and cut additional biscuits until dough is used.
-
Bake 12-15 minutes until golden and biscuits spring back when pressed.
-
Cool slightly before serving warm.
-
Serve as a flavorful gluten-free side with soups, salads, or vegan spreads.
Tips
Allergen Overlap Note
Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Quick & Easy Savory Chickpea and Carrot Biscuits for someone with celiac disease.
Texture Expectations
Gluten-Free Quick & Easy Savory Chickpea and Carrot Biscuits should keep the intended servings texture when cooked and plated carefully.
Dining With Non-GF Family Note
Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.
Frequently Asked Questions
- Can I make Gluten-Free Quick & Easy Savory Chickpea and Carrot Biscuits ahead?
- Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
- How do I keep this recipe gluten-free?
- Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
- Can I adjust the main ingredients?
- Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
- How do I serve it with mixed-diet family?
- Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.
Ingredient Replacements
- main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- garnish: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Storage and Reheating
Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register