Freeflourish

Breakfast

Gluten-Free Low-Carb Breakfast Omelette Muffins with Spinach and Chorizo

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 20, 2026 · Updated May 11, 2026
American-inspired 30 mins glutenfreelowcarbhighproteinfamilyfriendlykidfriendlyeasyquickrecipesbreakfastmealprep

Enjoy these easy gluten-free, low-carb breakfast omelette muffins packed with protein-rich eggs, flavorful chorizo, and nutrient-dense spinach. Perfect for family-friendly breakfasts, quick meal prep, and kid-friendly mornings.

Gluten-Free Low-Carb Breakfast Omelette Muffins with Spinach and Chorizo
Prep 10 min
Cook 20 min
Total 30 min
Servings 8
Difficulty easy
Cuisine American-inspired

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings8
Difficultyeasy
CuisineAmerican-inspired
Add To Favorites

Ingredients

Servings 8
  • 8 large eggs
  • 1/4 cup unsweetened almond milk (or preferred dairy-free milk)
  • 1/2 teaspoon sea salt
  • 1/4 teaspoon black pepper
  • 1/2 teaspoon garlic powder
  • 1/2 teaspoon smoked paprika
  • 4 ounces fresh chorizo sausage, casing removed and crumbled
  • 1 cup fresh spinach, roughly chopped
  • 1/2 small red bell pepper, finely diced
  • 1/4 cup chopped green onions (green and white parts)
  • 2 tablespoons fresh cilantro, chopped (optional)
  • 1 teaspoon olive oil or avocado oil (for cooking chorizo)

Instructions

  1. Preheat your oven to 350°F (175°C). Lightly grease a standard 12-cup muffin tin with cooking spray or oil.
  2. In a medium skillet over medium heat, add olive oil. Crumble in the chorizo and cook for about 5 minutes until browned and cooked through, stirring occasionally.
  3. Add the diced red bell pepper and cook for another 2 minutes until slightly softened. Remove the skillet from heat and let the mixture cool slightly.
  4. In a large mixing bowl, crack the eggs. Whisk together with almond milk, sea salt, black pepper, garlic powder, and smoked paprika until fully combined and slightly frothy.
  5. Fold in the chopped spinach, green onions, cilantro (if using), and the cooked chorizo and peppers.
  6. Pour the mixture evenly into the prepared muffin tin cups, filling each about 3/4 full.
  7. Bake in the preheated oven for 18 to 20 minutes, or until the muffins are set and lightly golden on top. A toothpick inserted into the center should come out clean.
  8. Remove from oven and let cool for 5 minutes, then carefully run a knife around each muffin to loosen and remove from the tin.
  9. Serve warm, or allow to cool completely and refrigerate in an airtight container for up to 4 days. These muffins freeze well for up to 1 month and reheat quickly in the microwave.
  10. Enjoy as a high-protein, low-carb breakfast or healthy snack that the whole family will love!

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

To customize these gluten-free low-carb breakfast omelette muffins for diverse dietary needs while keeping taste and nutrition intact, consider these ingredient swaps:

  • Dairy-Free Options: Replace almond milk with unsweetened coconut milk or oat milk if preferred.
  • Nut-Free Alternatives: Use oat milk, rice milk, or hemp milk instead of almond milk to avoid nuts.
  • Vegetarian Substitutes: Swap chorizo with plant-based sausage or seasoned mushrooms for a vegetarian-friendly version.
  • Vegan Variations: Though this recipe contains eggs, vegan muffins can be made using chickpea flour or tofu scramble, noting texture and flavor differences.
  • Low-Carb and Keto Friendly: All ingredients are inherently low-carb; ensure milk substitutes are also low in carbs.
  • Paleo/Whole30 Compliance: Choose nitrate-free, sugar-free sausage and use coconut milk instead of almond milk to meet paleo and Whole30 guidelines.
  • Kid-Friendly Modifications: For less spice, use mild turkey sausage or omit smoked paprika and chorizo in favor of diced ham.
  • Freezing Tips: These muffins freeze well; add extra veggies like zucchini or mushrooms for variety before baking.

These substitutions help tailor the recipe to your dietary preferences while maintaining the delicious essence of this family-friendly, easy, and quick breakfast or snack.

Allergen Overlap Note

Our gluten-free recipes, including Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, and Gluten-Free Baking, are carefully designed to minimize gluten exposure. To ensure safety for those with gluten intolerance or celiac disease, please keep in mind the following allergen and cross-contact precautions:

  • Cross-Contact Risk: Even trace amounts of gluten may cause reactions. Use dedicated gluten-free utensils, cookware, and prep surfaces to avoid contamination from gluten-containing foods.
  • Shared Ingredients: Some ingredients may be processed in facilities handling gluten, nuts, dairy, or soy. Always check product labels for certified gluten-free or allergen-free status.
  • Allergen Awareness: Many gluten-free recipes also accommodate dairy-free, nut-free, vegan, and low-carb diets, but individual sensitivities vary. Double-check ingredients if you have multiple dietary restrictions.
  • Safe Substitutions: When substituting (e.g., gluten-free flours or dairy alternatives), ensure replacements do not add allergens or affect recipe texture and flavor.
  • Meal Prep & Storage: Store gluten-free meals separately from gluten-containing foods and clearly label for family-friendly meal prep.

Following these guidelines will help you safely enjoy our diverse gluten-free and family-friendly recipes with confidence. For severe allergies, consult a healthcare professional.

Texture Expectations

Gluten-free dishes like these breakfast omelette muffins have a distinctive texture due to the absence of gluten, which provides elasticity and chewiness in traditional baked goods. Eggs serve as the binding and leavening agents here, creating a tender, slightly spongy texture that is moist and custard-like straight from the oven.

Expect a soft, airy crumb with a slight firmness on the edges from gentle browning. The cooked chorizo adds savory pockets with a meaty chew, complemented by the tender spinach and diced red pepper. Unlike gluten-containing muffins, these won’t be stretchy or chewy but will hold together with a delicate structure that resists crumbling.

Leftovers refrigerated will become denser and firmer, and reheating frozen muffins can dry them slightly; to maintain moisture, reheat gently covered. Thanks to their low-carb, high-protein profile, these muffins feel hearty yet light and digestible.

Overall, the texture is comforting, family-friendly, and ideal for quick breakfasts, meal prep, or satisfying snacks.

Dining With Non Gf Family Note

Preparing meals for gluten-free and non-gluten-free family members can be simple and enjoyable when following key precautions to avoid cross-contamination. Here are practical tips to ensure everyone can dine happily and safely together:

  • Separate Surfaces and Utensils: Use different cutting boards, knives, toasters, and kitchen tools for gluten-free cooking to prevent gluten exposure.
  • Thorough Cleaning: Wash countertops, cookware, and utensils well with hot, soapy water before gluten-free meal preparation.
  • Designated Storage: Store gluten-free flours, grains, and snacks in labeled, sealed containers separate from gluten-containing ingredients.
  • Cooking Order: Prepare gluten-free foods first or at different times to minimize cross-contact.
  • Shared Appliances: Avoid sharing toasters or frying oils between gluten and gluten-free items unless cleaned thoroughly or reserved only for gluten-free use.
  • Education: Teach family members the importance of gluten-free precautions to ensure consistent safe practices.
  • Labeling: Clearly label gluten-free dishes when sharing meals or packing lunches to prevent accidental gluten intake.

These strategies allow you to enjoy delicious gluten-free meals across Breakfast, Lunch, Dinner, Desserts, Soups & Salads, and Snacks, harmonizing dietary needs and family preferences—perfect for holiday classics, seasonal feasts, and everyday comfort food.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.