Breakfast
Freeflourish
Gluten-Free Low-Carb Breakfast Omelette Muffins with Spinach and Chorizo
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 20, 2026 · Updated Jul 7, 2026
American-inspired
30 mins
glutenfreelowcarbhighproteinfamilyfriendlykidfriendlyeasyquickrecipesbreakfastmealprep
Enjoy these easy gluten-free, low-carb breakfast omelette muffins packed with protein-rich eggs, flavorful chorizo, and nutrient-dense spinach. Perfect for family-friendly breakfasts, quick meal prep, and kid-friendly mornings.
Prep
10 min
Cook
20 min
Total
30 min
Servings
8
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
8
- 8 large eggs
- 1/4 cup unsweetened almond milk (or preferred dairy-free milk)
- 1/2 teaspoon sea salt
- 1/4 teaspoon black pepper
- 1/2 teaspoon garlic powder
- 1/2 teaspoon smoked paprika
- 4 ounces fresh chorizo sausage, casing removed and crumbled
- 1 cup fresh spinach, roughly chopped
- 1/2 small red bell pepper, finely diced
- 1/4 cup chopped green onions (green and white parts)
- 2 tablespoons fresh cilantro, chopped (optional)
- 1 teaspoon olive oil or avocado oil (for cooking chorizo)
Instructions
-
Preheat your oven to 350 degrees F. Lightly grease a standard 12-cup muffin tin with cooking spray or oil.
-
In a medium skillet over medium heat, add olive oil. Crumble in the chorizo and cook for about 5 minutes until browned and cooked through, stirring occasionally.
-
Add the diced red bell pepper and cook for another 2 minutes until slightly softened. Remove the skillet from heat and let the mixture cool slightly.
-
In a large mixing bowl, crack the eggs. Whisk together with almond milk, sea salt, black pepper, garlic powder, and smoked paprika until fully combined and slightly frothy.
-
Fold in the chopped spinach, green onions, cilantro (if using), and the cooked chorizo and peppers.
-
Pour the mixture evenly into the prepared muffin tin cups, filling each about 3/4 full.
-
Bake in the preheated oven for 18 to 20 minutes, or until the muffins are set and lightly golden on top. A toothpick inserted into the center should come out clean.
-
Remove from oven and let cool for 5 minutes, then carefully run a knife around each muffin to loosen and remove from the tin.
-
Serve warm, or allow to cool completely and refrigerate in an airtight container for up to 4 days. These muffins freeze well for up to 1 month and reheat quickly in the microwave.
-
Enjoy as a high-protein, low-carb breakfast or healthy snack that the whole family will love!
Tips
Allergen Overlap Note
Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces, dedicated utensils, and fresh parchment or cookware when preparing gluten-free omelette muffins with spinach and chorizo for someone with celiac disease.
Texture Expectations
Keep the muffins airy at the edges and softly set in the center. Bake from equal batched cups so they cook evenly and don’t pull away from pan sides.
Dining With Non-GF Family Note
Load each muffin tin half-full for kids, and keep regular breakfast breads or granola in a separate area. The oven-safe tins make serving with mixed diets easy.
Frequently Asked Questions
- Can I make Gluten-Free Low-Carb Breakfast Omelette Muffins with Spinach and Chorizo ahead?
- Yes. Prepare the components ahead when practical, then store and reheat according to the storage guidance so the texture stays close to fresh.
- How do I keep this recipe gluten-free?
- Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
- Can I adjust the main ingredients?
- Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.
- What is the best way to serve it with mixed-diet family?
- Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.
Ingredient Replacements
- main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- garnish: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Storage and Reheating
Store cooled muffins in an airtight container for up to 4 days. Reheat in a 300 degrees F oven until warmed, or chill before meal prep boxes.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register