Breakfast
Freeflourish
Gluten-Free High-Protein Chickpea and Quinoa Breakfast Bars
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 14, 2026 · Updated May 11, 2026
American-inspired
40 mins
glutenfreehighproteinfamilymealkidfriendlyeasyquickrecipesbreakfastsnackfreezablebudgetfriendly
Enjoy these gluten-free breakfast bars packed with protein-rich chickpeas and quinoa. Kid-friendly, freezable, and quick to prepare, they are ideal for busy mornings, snacks, or family-friendly meal prep.
Prep
15 min
Cook
25 min
Total
40 min
Servings
12
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
12
- 1 cup cooked quinoa, cooled
- 1 cup canned chickpeas, rinsed and drained
- 1/2 cup almond butter (or sunflower seed butter for nut-free option)
- 1/4 cup pure maple syrup
- 1 teaspoon vanilla extract
- 1/2 teaspoon ground cinnamon
- 1/4 teaspoon salt
- 1/4 cup gluten-free rolled oats
- 1/4 cup shredded unsweetened coconut
- 3 tablespoons ground flaxseed
- 1/4 cup mini dairy-free chocolate chips (optional)
- 2 tablespoons chia seeds (optional for extra protein and texture)
Instructions
-
Preheat your oven to 350°F (175°C). Line an 8-inch square baking pan with parchment paper, leaving some overhang for easy removal.
-
In a food processor, combine the cooked quinoa and chickpeas. Pulse until the mixture is roughly combined but still has some texture—avoid pureeing into a paste.
-
Add the almond butter, maple syrup, vanilla extract, cinnamon, and salt to the food processor. Pulse a few more times until well incorporated and sticky.
-
Transfer the mixture into a large mixing bowl. Stir in the gluten-free oats, shredded coconut, ground flaxseed, chia seeds (if using), and chocolate chips (if using). Mix thoroughly to combine.
-
Press the mixture evenly into the prepared baking pan, pressing firmly to pack the bars tightly.
-
Bake for 20-25 minutes until the edges are golden and the bars feel set to the touch.
-
Remove from the oven and let cool completely in the pan on a wire rack, about 30 minutes.
-
Once cooled, use the parchment paper overhang to lift the bars out of the pan. Cut into 12 equal-sized bars.
-
Store bars in an airtight container at room temperature for up to 3 days, or freeze for up to 3 months for convenient meal prep.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize these gluten-free, high-protein breakfast bars for specific dietary needs or preferences with these smart substitutions:
- Nut-Free: Swap almond butter for sunflower seed butter or pea butter, maintaining creaminess and protein without nuts.
- Dairy-Free: The recipe is naturally dairy-free; just confirm that any optional mini chocolate chips are dairy-free versions.
- Vegan: Fully vegan-friendly, featuring pure maple syrup as a natural sweetener.
- Low-Carb: Substitute quinoa and gluten-free oats with additional seeds like flaxseed meal or coconut flour, noting texture and flavor changes.
- High-Protein Boost: Add more chia seeds or replace part of the quinoa with cooked lentils or edamame for extra protein.
- Grain-Free: Omit gluten-free rolled oats; increase shredded coconut or seed quantities to maintain structure.
These flexible swaps keep the bars suitable for quick breakfasts, snacks, and family-friendly meals, adjusting easily to varied dietary lifestyles.
Allergen Overlap Note
Our curated gluten-free recipes—including those perfect for Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, Gluten-Free Baking, Quick & Easy, Family-Friendly, and Holiday & Seasonal occasions—are designed with safety in mind. To maintain gluten-free integrity, be aware of potential allergen cross-contamination risks.
Many Freeflourish recipes also address other dietary needs like dairy-free, nut-free, vegan, vegetarian, paleo, and whole30. However, ingredients such as nuts, seeds, dairy alternatives, and gluten-free grains may be processed in shared facilities.
- Always verify the gluten-free certification and allergen information on product labels.
- Use dedicated utensils, cookware, and preparation surfaces for gluten-free meals to avoid contamination.
- Store ingredients separately to prevent cross-contact with gluten or allergens.
- Clean all work areas thoroughly before preparing gluten-free dishes.
Following these guidelines ensures safe preparation of gluten-free meals tagged with glutenfree and related dietary labels like dairyfree, nutfree, vegan, vegetarian, kidfriendly, and quickrecipes.
Enjoy wholesome, safe gluten-free dishes—from comforting family meals to holiday classics—with confidence.
Texture Expectations
Gluten-free breakfast bars like these chickpea and quinoa bars offer a delightful texture blending softness with gentle chewiness. Without gluten’s elasticity, the bars rely on nutrient-rich ingredients for structure and mouthfeel.
The cooked quinoa and chickpeas create a tender, slightly grainy foundation, with the food processor pulsing just enough to retain texture rather than form a smooth paste.
Gluten-free rolled oats and shredded coconut add mild chewiness and fiber, while ground flaxseed and optional chia seeds provide subtle crunch and natural binding.
The bars have a moist interior that remains firm and sliceable once cooled, complemented by lightly crisp golden edges from baking. This balance makes them perfect for grab-and-go breakfasts or snacks.
Variations like using nut or seed butters may slightly change firmness or stickiness, and optional dairy-free chocolate chips contribute sweet pockets and a smooth finish.
Overall, expect a nourishing, satisfying bite that pairs well with quick, family-friendly, gluten-free breakfasts and snack ideas that also freeze well for meal prep convenience.
Dining With Non Gf Family Note
Preparing gluten-free meals alongside family members who eat gluten is easy with mindful practices that prevent cross-contamination and ensure everyone enjoys safe, delicious food.
- Designate Separate Tools and Areas: Use distinct cutting boards, utensils, and toaster slots for gluten-free preparation. Label items when helpful.
- Thoroughly Clean Surfaces: Wipe countertops, cookware, and appliances before preparing gluten-free dishes to remove crumbs and traces of gluten.
- Separate Storage: Store gluten-containing and gluten-free products in different places to avoid accidental contact.
- Cook Gluten-Free First: Prepare gluten-free meals before gluten-containing dishes, reducing cross-contact risk from shared equipment.
- Choose Naturally Gluten-Free Recipes: Adapt favorite family recipes to be gluten-free, easing mealtime for everyone.
- Communicate Awareness: Share gluten-free requirements openly with family to encourage supportive cooking and dining habits.
- Plan Family-Friendly Meals: Utilize recipes across Freeflourish’s categories like Breakfast, Lunch, Dinner, Desserts, and Snacks, incorporating relevant tags like dairy-free, nut-free, and vegan for inclusive meals.
- Check Garnishes and Condiments: Ensure toppings, sauces, and dressings are gluten-free to maintain meal safety.
These steps promote harmony and health when sharing meals in mixed gluten and gluten-free households, allowing everyone to enjoy wholesome, family-friendly gluten-free recipes.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register