How do I keep this recipe gluten-free?

Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.

Can I adjust the main ingredients?

Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.

What is the best way to serve it with mixed-diet family?

Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.

Back to Recipes

Appetizers

Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema

Name: Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema
Prep time: 10 min
Cook time: 15 min
Total time: 25 min
Yield: 4 servings
Cuisine: American-inspired
Ingredients: 1 ½ cups fresh or frozen sweet corn kernels (if frozen, thaw and drain well); 2 large eggs; 3 tablespoons chickpea flour (or any gluten-free flour blend); 2 tablespoons finely chopped fresh chives; ½ teaspoon baking powder (gluten-free); ¼ teaspoon salt; ¼ teaspoon black pepper; 1 small garlic clove, minced; 2 tablespoons finely diced red bell pepper (optional for color and flavor); 2 tablespoons olive oil or avocado oil, for frying; For the Avocado Crema:; 1 ripe avocado; 2 tablespoons fresh lime juice; 2 tablespoons unsweetened dairy-free yogurt (e.g. coconut or almond yogurt); ¼ teaspoon garlic powder; Salt and pepper to taste; 2-3 tablespoons water to thin, as needed

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 15, 2026 · Updated Jul 6, 2026

American-inspired 25 mins glutenfreevegetariandairyfreekidfriendlyhighproteinappetizereasyhealthyfamilyfriendlyquickrecipes

These gluten-free sweet corn and chive fritters are a crispy, high-protein, vegetarian, and dairy-free treat, served with a smooth avocado crema. Perfect for quick, healthy, family-friendly appetizers, snacks, or light dinners that are easy to prepare.

Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema

Prep 10 min

Cook 15 min

Total 25 min

Servings 4

Difficulty easy

Cuisine American-inspired

Ingredients

Servings 4

1 ½ cups fresh or frozen sweet corn kernels (if frozen, thaw and drain well)
2 large eggs
3 tablespoons chickpea flour (or any gluten-free flour blend)
2 tablespoons finely chopped fresh chives
½ teaspoon baking powder (gluten-free)
¼ teaspoon salt
¼ teaspoon black pepper
1 small garlic clove, minced
2 tablespoons finely diced red bell pepper (optional for color and flavor)
2 tablespoons olive oil or avocado oil, for frying
For the Avocado Crema
1 ripe avocado
2 tablespoons fresh lime juice
2 tablespoons unsweetened dairy-free yogurt (e.g. coconut or almond yogurt)
¼ teaspoon garlic powder
Salt and pepper to taste
2-3 tablespoons water to thin, as needed

FreeFlourish gluten-free sweet corn and chive fritters with avocado crema ingredients

Instructions

In a large mixing bowl, lightly beat the eggs.
Whisk in chickpea flour, baking powder, salt, pepper, and minced garlic until smooth and lump-free.
Fold in sweet corn kernels, chopped chives, and diced red bell pepper (if using), mixing gently to combine evenly.
Prepare avocado crema by blending avocado, lime juice, dairy-free yogurt, garlic powder, salt, and pepper in a blender or food processor.
Add water one tablespoon at a time while blending until the crema reaches a smooth, creamy dipping consistency; refrigerate until serving.
Heat 1 tablespoon of oil in a large non-stick skillet over medium heat.
Scoop about 3 tablespoons of batter per fritter into the skillet, flattening slightly with the back of a spoon to form patties.
Cook 3-4 minutes per side until golden brown and crispy.
Transfer cooked fritters to a paper towel-lined plate to drain excess oil, keeping warm.
Add remaining oil and fry remaining batter in batches, adding more oil if needed.
Serve warm fritters with the dairy-free avocado crema for dipping.

FreeFlourish sweet corn and chive fritters with avocado crema finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces, dedicated utensils, and fresh parchment or cookware when preparing sweet corn and chive fritters with avocado crema for someone with celiac disease.

Texture Expectations

The fritters should be crisp on the outside and soft in the center, with chickpea flour binding the corn without making the batter heavy. Drain thawed corn well so the fritters brown instead of steaming.

Dining With Non-GF Family Note

Serve the fritters on a dedicated gluten-free platter with the avocado crema in a clean bowl. Keep crackers, bread, or shared dipping utensils away from the fritters during mixed-diet snacking.

Frequently Asked Questions

Can I make Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema ahead?: Yes. Prepare the components ahead when practical, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?: Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?: Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.
What is the best way to serve it with mixed-diet family?: Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.

Ingredient Replacements

½ cups fresh or frozen sweet corn kernels (if frozen: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
½ teaspoon baking powder: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
¼ teaspoon salt: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
¼ teaspoon black pepper: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
For the Avocado Crema:: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Store cooled fritters and crema separately in airtight containers for up to 3 days. Reheat fritters in a skillet or 350 degrees F oven until crisp, and stir the crema before serving.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema

Recipe Details

Ingredients

Instructions