Breakfast
Freeflourish
Gluten-Free Sweet Corn and Chive Fritters with Avocado Crema
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 15, 2026 · Updated May 11, 2026
American-inspired
25 mins
glutenfreevegetariandairyfreekidfriendlyhighproteinappetizereasyhealthyfamilyfriendlyquickrecipes
These gluten-free sweet corn and chive fritters are a crispy, high-protein, vegetarian, and dairy-free treat, served with a smooth avocado crema. Perfect for quick, healthy, family-friendly appetizers, snacks, or light dinners that are easy to prepare.
Prep
10 min
Cook
15 min
Total
25 min
Servings
4
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
4
- 1 ½ cups fresh or frozen sweet corn kernels (if frozen, thaw and drain well)
- 2 large eggs
- 3 tablespoons chickpea flour (or any gluten-free flour blend)
- 2 tablespoons finely chopped fresh chives
- ½ teaspoon baking powder (gluten-free)
- ¼ teaspoon salt
- ¼ teaspoon black pepper
- 1 small garlic clove, minced
- 2 tablespoons finely diced red bell pepper (optional for color and flavor)
- 2 tablespoons olive oil or avocado oil, for frying
- For the Avocado Crema
- 1 ripe avocado
- 2 tablespoons fresh lime juice
- 2 tablespoons unsweetened dairy-free yogurt (e.g. coconut or almond yogurt)
- ¼ teaspoon garlic powder
- Salt and pepper to taste
- 2-3 tablespoons water to thin, as needed
Instructions
-
In a large mixing bowl, lightly beat the eggs.
-
Whisk in chickpea flour, baking powder, salt, pepper, and minced garlic until smooth and lump-free.
-
Fold in sweet corn kernels, chopped chives, and diced red bell pepper (if using), mixing gently to combine evenly.
-
Prepare avocado crema by blending avocado, lime juice, dairy-free yogurt, garlic powder, salt, and pepper in a blender or food processor.
-
Add water one tablespoon at a time while blending until the crema reaches a smooth, creamy dipping consistency; refrigerate until serving.
-
Heat 1 tablespoon of oil in a large non-stick skillet over medium heat.
-
Scoop about 3 tablespoons of batter per fritter into the skillet, flattening slightly with the back of a spoon to form patties.
-
Cook 3-4 minutes per side until golden brown and crispy.
-
Transfer cooked fritters to a paper towel-lined plate to drain excess oil, keeping warm.
-
Add remaining oil and fry remaining batter in batches, adding more oil if needed.
-
Serve warm fritters with the dairy-free avocado crema for dipping.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize this Gluten-Free Sweet Corn and Chive Fritters recipe to your dietary needs or ingredient availability with these simple substitutions:
- Sweet Corn: Substitute canned (drained) or frozen sweet corn kernels when fresh aren't available.
- Eggs: For vegan diets, use 2 tablespoons aquafaba or one flaxseed egg (1 tablespoon ground flaxseed mixed with 3 tablespoons water, set to gel) per egg.
- Chickpea Flour: Replace with any gluten-free flour blend such as rice, sorghum, or oat flour while maintaining gluten-free status.
- Dairy-Free Yogurt (Avocado Crema): Use plant-based yogurts like coconut, almond, or cashew for creamy, dairy-free results.
- Frying Oil: Opt for avocado oil, olive oil, or neutral high-smoke-point oils like grapeseed oil according to preference.
- Red Bell Pepper (Optional): Omit or swap with finely diced zucchini or green onion for color and flavor variations.
These replacements keep the recipe gluten-free, vegetarian, dairy-free, kidfriendly, and easy while allowing adaptations for vegan or other dietary preferences without sacrificing flavor or texture.
Allergen Overlap Note
Our diverse gluten-free recipe collection spans Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, and Gluten-Free Baking. While designed to avoid gluten, please remain mindful of allergen cross-contamination risks in the kitchen.
Many recipes tagged glutenfree may include or be prepared alongside ingredients like dairy, nuts, eggs, or soy. For sensitivities or dietary choices including dairyfree, nutfree, vegan, and paleo, always verify ingredient labels and consider using separate utensils and surfaces to prevent cross-contact.
Check packaging for gluten-free certification and allergen warnings. Clean cookware thoroughly and use dedicated equipment when possible to ensure safe, allergen-conscious cooking.
Our family-friendly and kidfriendly dishes include tags like easy, quickrecipes, and 30minutesorless to help you prepare safe and convenient meals without compromising on taste or nutrition.
Thank you for choosing Freeflourish for your gluten-free and allergen-aware cooking journey. Consult healthcare professionals or allergists for personalized advice.
Texture Expectations
Gluten-free recipes, especially those using chickpea flour, offer unique textures compared to traditional wheat-based dishes. These Sweet Corn and Chive Fritters feature a delightful balance between a crispy golden exterior and a tender, moist interior.
Exterior Texture: When pan-fried properly, the fritters develop a crunchy, golden-brown crust from the chickpea flour and oil. Proper oil temperature and frying time are essential — too little heat or overcrowding can cause a softer crust.
Interior Texture: Inside, expect moist, slightly dense fritters due to the juicy sweet corn kernels and egg binder. The texture differs from lighter wheat fritters but delivers a hearty bite. Fresh chives and optional red bell pepper add subtle texture and color bursts.
Variations: Using different gluten-free flours may alter texture slightly; chickpea flour yields a substantial feel while other blends might be lighter. For extra crispness, ensure hot oil and avoid steaming by not crowding the pan.
Enjoy these fritters fresh for the best savory crunch. They reheat well and retain texture if gently warmed. The creamy, dairy-free avocado crema balances the crisp fritters with a smooth, cool dip.
Dining With Non Gf Family Note
Preparing gluten-free meals alongside family members who eat gluten requires careful planning for safe and inclusive dining. Follow these tips to avoid cross-contamination and share meals comfortably across categories like Breakfast, Lunch, Dinner, Desserts, and Snacks:
- Separate Prep Areas: Use designated surfaces, cutting boards, and utensils exclusively for gluten-free cooking.
- Clean Cookware: Employ separate pans and trays or thoroughly clean shared cookware before gluten-free use.
- Certified Gluten-Free Ingredients: Use flours, baking powder, and snacks labeled gluten-free, especially for baking and quick meals.
- Shared Appliances: Use toaster bags or liners when grilling gluten-containing foods, or have separate appliances for gluten-free cooking.
- Storage: Clearly label and store gluten-free ingredients and leftovers separately to prevent mix-ups, essential for familyfriendly and mealprep scenarios.
- Communication: Educate family members about gluten-free practices to ensure consistent safety during all meal preparations.
- Plan Inclusive Meals: Choose naturally gluten-free options from categories like Soups & Salads, Gluten-Free Baking, or Holiday & Seasonal dishes to reduce cross-contamination risks and enjoy family-friendly dining.
- Quick & Easy Options: Keep gluten-free snacks and quickrecipes handy for effortless, safe meals.
These strategies enable shared delicious meals safely across diverse dietary needs, promoting stress-free and inclusive family dining.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register