Breakfast
Freeflourish
Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 23, 2026 · Updated Jul 7, 2026
Mediterranean-inspired
30 mins
glutenfreevegandairyfreeonepot30minutesorlesseasyhealthycomfortfoodquickrecipesfamilyfriendlykidfriendly
This quick roasted tomato and red lentil soup is a delicious Mediterranean-inspired, gluten-free, vegan, and dairy-free recipe. Packed with smoky roasted tomatoes and high-protein red lentils, it’s a satisfying one-pot meal perfect for healthy lunches, dinners, or snacks ready in under 30 minutes.
Prep
10 min
Cook
20 min
Total
30 min
Servings
4
Difficulty
easy
Cuisine
Mediterranean-inspired
Ingredients
Servings
4
- 6 medium ripe tomatoes, halved
- 1 tablespoon olive oil
- 1 teaspoon smoked paprika
- 1/2 teaspoon ground cumin
- 1 cup red lentils, rinsed
- 1 medium onion, finely chopped
- 3 garlic cloves, minced
- 4 cups vegetable broth (gluten-free)
- 1 tablespoon tomato paste
- Salt and freshly ground black pepper to taste
- Juice of 1 lemon
- Fresh parsley or cilantro, chopped (for garnish)
Instructions
-
Preheat your oven to 425 degrees F. Line a baking tray with parchment paper.
-
Place the halved tomatoes on the tray cut side up. Drizzle with olive oil and sprinkle smoked paprika and ground cumin evenly over them.
-
Roast the tomatoes in the oven for 15 minutes until they start to caramelize and become soft.
-
While the tomatoes roast, heat a large pot over medium heat. Add a splash of olive oil, then sauté the onion until translucent, about 3-4 minutes.
-
Add the minced garlic and cook for another minute until fragrant.
-
Add the tomato paste to the pot and stir well with the onions and garlic.
-
Once the tomatoes are roasted, add them (including any juices) to the pot along with the rinsed red lentils and vegetable broth.
-
Bring the soup to a boil, then reduce heat and simmer uncovered for 12-15 minutes until the lentils are tender.
-
Use an immersion blender to purée the soup until smooth or leave slightly chunky, depending on your preference.
-
Season with salt, pepper, and lemon juice to brighten the flavors. Stir well.
-
Serve hot, garnished with fresh parsley or cilantro.
Tips
Allergen Overlap Note
Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup for someone with celiac disease.
Texture Expectations
Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup should keep the intended servings texture when cooked and plated carefully.
Dining With Non-GF Family Note
Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.
Frequently Asked Questions
- Can I make Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup ahead?
- Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
- How do I keep this recipe gluten-free?
- Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
- Can I adjust the main ingredients?
- Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
- How do I serve it with mixed-diet family?
- Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.
Ingredient Replacements
- Salt and freshly ground black pepper to taste: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- Juice of 1 lemon: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- Fresh parsley or cilantro: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Storage and Reheating
Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register