Freeflourish
Back to Recipes

Quick & Easy

Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 23, 2026 · Updated May 11, 2026
Mediterranean-inspired 30 mins glutenfreevegandairyfreeonepot30minutesorlesseasyhealthycomfortfoodquickrecipesfamilyfriendlykidfriendly

This quick roasted tomato and red lentil soup is a delicious Mediterranean-inspired, gluten-free, vegan, and dairy-free recipe. Packed with smoky roasted tomatoes and high-protein red lentils, it’s a satisfying one-pot meal perfect for healthy lunches, dinners, or snacks ready in under 30 minutes.

Gluten-Free Quick & Easy Roasted Tomato and Red Lentil Soup
Prep 10 min
Cook 20 min
Total 30 min
Servings 4
Difficulty easy
Cuisine Mediterranean-inspired

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings4
Difficultyeasy
CuisineMediterranean-inspired
Add To Favorites

Ingredients

Servings 4
  • 6 medium ripe tomatoes, halved
  • 1 tablespoon olive oil
  • 1 teaspoon smoked paprika
  • 1/2 teaspoon ground cumin
  • 1 cup red lentils, rinsed
  • 1 medium onion, finely chopped
  • 3 garlic cloves, minced
  • 4 cups vegetable broth (gluten-free)
  • 1 tablespoon tomato paste
  • Salt and freshly ground black pepper to taste
  • Juice of 1 lemon
  • Fresh parsley or cilantro, chopped (for garnish)

Instructions

  1. Preheat your oven to 425°F (220°C). Line a baking tray with parchment paper.
  2. Place the halved tomatoes on the tray cut side up. Drizzle with olive oil and sprinkle smoked paprika and ground cumin evenly over them.
  3. Roast the tomatoes in the oven for 15 minutes until they start to caramelize and become soft.
  4. While the tomatoes roast, heat a large pot over medium heat. Add a splash of olive oil, then sauté the onion until translucent, about 3-4 minutes.
  5. Add the minced garlic and cook for another minute until fragrant.
  6. Add the tomato paste to the pot and stir well with the onions and garlic.
  7. Once the tomatoes are roasted, add them (including any juices) to the pot along with the rinsed red lentils and vegetable broth.
  8. Bring the soup to a boil, then reduce heat and simmer uncovered for 12-15 minutes until the lentils are tender.
  9. Use an immersion blender to purée the soup until smooth or leave slightly chunky, depending on your preference.
  10. Season with salt, pepper, and lemon juice to brighten the flavors. Stir well.
  11. Serve hot, garnished with fresh parsley or cilantro.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

This versatile gluten-free, vegan, and dairy-free Roasted Tomato and Red Lentil Soup is easy to adapt for various dietary preferences. Consider these ingredient substitutions:

  • Red Lentils: Substitute with cooked cauliflower rice or finely chopped zucchini for a lower-carb, grain-free option while maintaining texture.
  • Vegetable Broth: Use certified gluten-free or homemade broth to avoid hidden gluten. Mushroom broth adds a deep, earthy flavor while keeping it dairy-free.
  • Olive Oil: For paleo or nut-free diets, swap with avocado or coconut oil.
  • Tomatoes: Fresh ripe tomatoes are best, but canned fire-roasted tomatoes offer a convenient, gluten-free, vegan alternative when fresh are unavailable.

Note: Avoid non-vegan toppings like cream or cheese to keep the soup fully vegan and dairy-free. These substitutions maintain the soup’s alignment with gluten-free, vegan, quick & easy, and healthy eating preferences.

Allergen Overlap Note

While this gluten-free Roasted Tomato and Red Lentil Soup and other recipes in our Gluten-Free category are crafted without gluten-containing ingredients, it’s essential to be cautious of potential cross-contamination in your kitchen. Ingredients labeled gluten-free may still encounter gluten during manufacturing or packaging.

Moreover, many recipes across categories like Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, Gluten-Free Baking, Quick & Easy, Family-Friendly, and Holiday & Seasonal include tags such as dairyfree, nutfree, vegan, and vegetarian. Since sensitivities often overlap, consider these safety tips:

  • Check allergen labels and gluten-free certifications on all packaged ingredients.
  • Thoroughly clean all utensils, cutting boards, and cookware before use.
  • Use separate appliances or preparation areas if managing celiac disease or severe allergies.
  • Be cautious with gluten-free baking flours or starches as they might contain traces of nuts or other allergens.
  • For familyfriendly and kidfriendly recipes, always confirm ingredient safety for your household.

These steps help ensure safe, inclusive meals across all dietary needs and recipe categories.

Texture Expectations

This gluten-free Roasted Tomato and Red Lentil Soup offers a warm, comforting texture that can be customized from smooth to slightly chunky. The roasting softens the tomatoes, while red lentils add a naturally creamy body without gluten-containing thickeners.

When fully puréed, expect a velvety smooth, luscious soup reminiscent of classic blended soups but without any graininess or gluten ingredients. Leaving some texture intact delivers a rustic feel with tender vegetable bits, perfect for those who enjoy varied mouthfeel.

As a one-pot and quick & easy recipe, the soup is hearty yet light and nourishing. The natural starches from red lentils gently thicken the soup as it cools but keep it easily reheatable and freezable without losing quality or texture.

Unlike gluten-based soups that rely on flour or roux, this recipe’s texture is fully from legumes and roasted vegetables—offering a wholesome, healthy alternative. Adjust blending to your preference for a creamier or chunkier consistency.

Overall, this soup exemplifies satisfying and comforting textures achievable in gluten-free, vegan, and dairy-free cooking, delivering a rich mouthfeel without gluten agents.

Dining With Non Gf Family Note

Preparing gluten-free meals that everyone in the family can enjoy, including those who are not gluten-sensitive, requires attention to prevent gluten cross-contamination. Follow these practical tips for safe gluten-free cooking for Breakfast, Lunch, Dinner, Desserts, Snacks, and Soups & Salads:

  • Use Separate Tools: Maintain dedicated cutting boards, utensils, toasters, and pans for gluten-free food preparation. Color-coded or clearly labeled tools reduce risks of accidental gluten exposure.
  • Clean Surfaces Thoroughly: Always clean kitchen surfaces and equipment before starting to avoid gluten dust or crumbs.
  • Store Gluten-Free Ingredients Separately: Keep gluten-free flours and products in sealed, separate containers to avoid mix-ups—especially important for Gluten-Free Baking and Holiday & Seasonal items.
  • Cook Gluten-Free Foods First or Separately: Prepare gluten-free dishes before others or in separate areas when possible.
  • Label Gluten-Free Dishes: Clearly mark gluten-free options during meals or gatherings, which is particularly helpful for Family-Friendly and Holiday Classic events.
  • Avoid Cross-Use of Condiments: Use single-serving packets or dedicated containers to prevent gluten contamination.
  • Educate Family Members: Share basic guidelines about gluten cross-contact to foster a supportive kitchen environment.

With these mindful strategies, you can prepare safe, delicious gluten-free meals suitable for all, from quick family dinners to festive seasonal celebrations.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.