Freeflourish

Desserts

Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding

By Freeflourish Editorial TeamPublished Apr 24, 2026 | Updated Jul 7, 2026
Tropical-inspired 25 mins glutenfreedairyfreeeasyquickrecipesdessertfamilyfriendlyseasonalholidayclassic30minutesorless

Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding with measured ingredients, 25-minute timing, 6-serving yield, and step-by-step instructions for gluten-free meals, baking, snacks, and desserts.

Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding
Prep 10 min
Cook 15 min
Total 25 min
Servings 6
Difficulty easy
Cuisine Tropical-inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings6
Difficultyeasy
CuisineTropical-inspired
Add To Favorites

Ingredients

Servings 6
  • 1/2 cup small pearl tapioca (gluten-free)
  • 2 1/2 cups canned full-fat coconut milk
  • 1/4 cup maple syrup or honey (use maple syrup for vegan option)
  • 1 teaspoon vanilla extract
  • 1/4 teaspoon salt
  • 1 large ripe mango, peeled and diced
  • toasted coconut flakes, fresh mint leaves
FreeFlourish Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding ingredients
FreeFlourish Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding ingredients

Instructions

  1. Rinse the tapioca pearls under cold running water to remove excess starch, then drain thoroughly.
  2. In a medium saucepan, combine the gluten-free tapioca pearls, full-fat coconut milk, maple syrup (or honey), and salt. Stir to combine.
  3. Bring the mixture to a gentle boil over medium heat, then reduce to low heat. Simmer uncovered, stirring frequently, for about 15 minutes until the tapioca pearls turn translucent and the pudding thickens. Avoid burning the mixture on the bottom.
  4. Remove the saucepan from heat and stir in the vanilla extract.
  5. Allow the pudding to cool slightly for 5 minutes, then carefully fold in the fresh diced mango, reserving some for garnish if desired.
  6. Spoon the pudding into serving bowls or ramekins. Garnish with reserved mango chunks, toasted coconut flakes, or fresh mint leaves as preferred.
  7. Serve warm for a comforting dessert or chill in the refrigerator for at least 30 minutes for a refreshing cold treat. The pudding will thicken further when cooled.
  8. Enjoy this quick, tropical, gluten-free coconut mango tapioca pudding that’s perfect for family meals and seasonal dessert occasions.
FreeFlourish Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding finished dish
FreeFlourish Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding for someone with celiac disease.

Texture Expectations

Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding should keep the intended pieces texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Quick & Easy Coconut Mango Tapioca Pudding ahead?
Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?
Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?
Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?
Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Related Articles

Read related guides and practical cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.