Breakfast
Freeflourish
Gluten-Free Paleo Cauliflower Tater Tots with Garlic Aioli
By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 15, 2026 · Updated Jul 6, 2026
American-inspired
40 mins
glutenfreepaleodairyfreegrainfreesnackkidfriendlyfamilyfriendlyeasyhealthyappetizerlowcarb
Enjoy these crispy, golden Gluten-Free Paleo Cauliflower Tater Tots—a wholesome, grain-free snack perfect for family-friendly gatherings. Paired with a tangy, dairy-free garlic aioli, this easy and healthy appetizer fits perfectly into your gluten-free baking and healthy snacking routine.
Prep
15 min
Cook
25 min
Total
40 min
Servings
4
Difficulty
easy
Cuisine
American-inspired
Ingredients
Servings
4
- 1 medium head cauliflower (about 4 cups riced)
- 2 large eggs
- 1/2 cup almond flour
- 1/4 cup finely chopped green onions (optional)
- 1 teaspoon garlic powder
- 1/2 teaspoon onion powder
- 1/2 teaspoon smoked paprika
- 1/2 teaspoon sea salt
- 1/4 teaspoon black pepper
- 2 tablespoons coconut oil (melted) or avocado oil, plus more for greasing
- For the Garlic Aioli
- 1/2 cup vegan mayonnaise
- 2 cloves garlic, minced
- 1 tablespoon fresh lemon juice
- 1/4 teaspoon sea salt
- Freshly ground black pepper, to taste
Instructions
-
Preheat the oven to 400 degrees F. Line a baking sheet with parchment paper and lightly grease it with coconut or avocado oil.
-
Wash and chop the cauliflower into florets. Pulse in a food processor until it reaches a rice-like texture, about 30 seconds, being careful not to over-process.
-
Place the riced cauliflower in a microwave-safe bowl and microwave on high for 5 minutes to soften. Let cool slightly.
-
Once cooled, transfer the cauliflower rice to a clean kitchen towel or cheesecloth and squeeze out as much moisture as possible. This step is crucial for crispy gluten-free tots.
-
In a large bowl, combine the cauliflower rice, eggs, almond flour, green onions (if using), garlic powder, onion powder, smoked paprika, sea salt, and black pepper. Mix well until the mixture holds together.
-
Scoop about 2 tablespoons of the mixture and shape into small, tot-sized cylinders or ovals by hand. Place the tots on the prepared baking sheet.
-
Brush or lightly drizzle the tops of the tots with melted coconut or avocado oil to enhance crispness during baking.
-
Bake for 20-25 minutes, turning once halfway through, until golden brown and crispy on all sides.
-
While the tots bake, prepare the garlic aioli by combining vegan mayonnaise, minced garlic, lemon juice, sea salt, and freshly ground black pepper in a small bowl. Stir well and refrigerate until serving.
-
Remove the tots from the oven and let them cool slightly before serving with the flavorful garlic aioli dipping sauce.
Tips
Allergen Overlap Note
Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces, dedicated utensils, and fresh parchment or cookware when preparing paleo cauliflower tater tots with garlic aioli for someone with celiac disease.
Texture Expectations
The tots should be crisp and golden outside with a tender cauliflower center. Squeezing moisture from the riced cauliflower is the key step that keeps the grain-free mixture from turning soft.
Dining With Non-GF Family Note
Serve the tots on a dedicated gluten-free snack plate with aioli in a clean dipping bowl. If other dippers or breaded snacks are on the table, use separate plates and separate dipping spoons.
Frequently Asked Questions
- Can I make Gluten-Free Paleo Cauliflower Tater Tots with Garlic Aioli ahead?
- Yes. Prepare the components ahead when practical, then store and reheat according to the storage guidance so the texture stays close to fresh.
- How do I keep this recipe gluten-free?
- Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
- Can I adjust the main ingredients?
- Yes. Use the ingredient replacement notes to choose swaps with similar moisture, protein, or cooking behavior.
- What is the best way to serve it with mixed-diet family?
- Serve the gluten-free recipe first with dedicated utensils, then keep any gluten-containing sides or toppings separate.
Ingredient Replacements
- For the Garlic Aioli:: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- Freshly ground black pepper: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
- seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Storage and Reheating
Refrigerate cooled tots in an airtight container for up to 4 days. Reheat on a baking sheet in a 375 degrees F oven until hot and crisp, and keep the aioli chilled.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register