Freeflourish

Quick & Easy

Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 28, 2026 · Updated Jul 7, 2026
Italian-inspired 25 mins glutenfreevegandairyfreefamilyfriendlyeasyquickrecipesmaincoursehealthy

This quick and healthy gluten-free vegan main course features a creamy walnut and kale pesto that's dairy-free and family-friendly. Ideal for busy weeknights, it combines nutritious ingredients with easy preparation. Walnut substitutes are suggested for nut-free adaptations.

Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine Italian-inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineItalian-inspired
Add To Favorites

Ingredients

Servings 4
  • 12 oz gluten-free pasta (such as penne or fusilli)
  • 3 cups kale leaves, stems removed and chopped
  • 1/2 cup walnuts, toasted (see ingredient replacements for nut-free options)
  • 2 cloves garlic, minced
  • 1/4 cup nutritional yeast
  • 1/4 cup extra virgin olive oil
  • 2 tablespoons lemon juice, freshly squeezed
  • 1/4 teaspoon salt, or to taste
  • 1/4 teaspoon freshly ground black pepper
  • 1/4 cup water or reserved pasta cooking water
  • fresh basil leaves and lemon zest
FreeFlourish Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta ingredients
FreeFlourish Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta ingredients

Instructions

  1. Bring a large pot of salted water to a boil. Cook the gluten-free pasta according to package instructions until al dente. Reserve 1/4 cup pasta cooking water before draining.
  2. While the pasta cooks, prepare the walnut and kale pesto: In a food processor, combine the toasted walnuts, chopped kale, minced garlic, nutritional yeast, lemon juice, salt, and pepper.
  3. Pulse the ingredients a few times to break them down slightly.
  4. With the food processor running, slowly drizzle in the olive oil and water (start with 1/4 cup), blending until the pesto reaches your desired creamy consistency. Add more water if needed to thin it out.
  5. Taste and adjust seasoning with additional salt, pepper, or lemon juice as desired to brighten flavors.
  6. Toss the drained pasta immediately with the walnut and kale pesto until evenly coated. If pesto is too thick, stir in reserved pasta water a tablespoon at a time to loosen.
  7. Serve the pasta warm, garnished with fresh basil leaves and lemon zest for a refreshing finish.
  8. Enjoy this quick, healthy, and flavorful gluten-free vegan walnut and kale pesto pasta as a perfect family-friendly main course!
FreeFlourish Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta finished dish
FreeFlourish Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta for someone with celiac disease.

Texture Expectations

Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta should keep the intended servings texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Easy Vegan Walnut and Kale Pesto Pasta ahead?
Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?
Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?
Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?
Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Ingredient Replacements

  • fresh basil leaves and lemon zest: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
  • main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
  • protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
  • seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
  • cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.