How do I keep this recipe gluten-free?

Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.

Can I adjust the main ingredients?

Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.

How do I serve it with mixed-diet family?

Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Back to Recipes

Soups & Salads

Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado

Name: Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado
Prep time: 15 min
Total time: 15 min
Yield: 4 servings
Cuisine: Mediterranean-inspired
Ingredients: 4 large ripe tomatoes, roughly chopped; 1 medium cucumber, peeled and chopped; 1 red bell pepper, seeded and chopped; 1 small red onion, roughly chopped; 2 cloves garlic; 1 ripe avocado, peeled and pitted; 3 tbsp extra virgin olive oil; 2 tbsp red wine vinegar; 1 cup cold filtered water; 1/2 cup fresh parsley leaves; 1/4 cup fresh basil leaves; 1/4 cup fresh cilantro leaves; 1 tsp sea salt, or to taste; 1/4 tsp freshly ground black pepper; diced avocado, fresh herb sprigs, drizzle of olive oil

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 24, 2026 · Updated Jul 7, 2026

Mediterranean-inspired 15 mins glutenfreevegandairyfreefamilyfriendlyhealthyeasyappetizercoldseasonalquickrecipes

This cold Mediterranean-inspired gazpacho blends garden-fresh tomatoes, cucumbers, peppers, and fresh herbs with creamy avocado for a nourishing gluten-free, vegan, and dairy-free appetizer. It’s quick, easy, and perfect for family-friendly meals and healthy seasonal dining.

Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado

Prep 15 min

Cook 0 min

Total 15 min

Servings 4

Difficulty easy

Cuisine Mediterranean-inspired

Ingredients

Servings 4

4 large ripe tomatoes, roughly chopped
1 medium cucumber, peeled and chopped
1 red bell pepper, seeded and chopped
1 small red onion, roughly chopped
2 cloves garlic
1 ripe avocado, peeled and pitted
3 tbsp extra virgin olive oil
2 tbsp red wine vinegar
1 cup cold filtered water
1/2 cup fresh parsley leaves
1/4 cup fresh basil leaves
1/4 cup fresh cilantro leaves
1 tsp sea salt, or to taste
1/4 tsp freshly ground black pepper
diced avocado, fresh herb sprigs, drizzle of olive oil

FreeFlourish Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado ingredients

Instructions

In a high-powered blender or food processor, combine the chopped tomatoes, cucumber, red bell pepper, red onion, and garlic. Pulse until roughly chopped but still slightly chunky for texture.
Add the ripe avocado, olive oil, red wine vinegar, cold water, parsley, basil, cilantro, sea salt, and black pepper to the blender.
Blend on high until the soup is smooth and creamy. Taste and adjust seasoning with additional salt, pepper, or vinegar as preferred.
Transfer gazpacho to a large bowl or pitcher. Cover and refrigerate for at least 1 hour to allow flavors to meld and serve well chilled.
When ready to serve, stir the gazpacho gently. Ladle into bowls and garnish with diced avocado, a drizzle of olive oil, and fresh herb sprigs if desired.
Serve immediately cold as a refreshing appetizer or light lunch during warm weather.

FreeFlourish Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado for someone with celiac disease.

Texture Expectations

Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado should keep the intended bowls texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado ahead?: Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?: Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?: Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?: Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Ingredient Replacements

diced avocado: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Gluten-Free Garden Gazpacho with Fresh Herbs and Avocado

Recipe Details

Ingredients

Instructions