How do I keep this recipe gluten-free?

Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.

Can I adjust the main ingredients?

Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.

How do I serve it with mixed-diet family?

Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Back to Recipes

Quick & Easy

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups

Name: Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups
Prep time: 10 min
Cook time: 10 min
Total time: 20 min
Yield: 4 servings
Cuisine: Mexican-inspired
Ingredients: 1 lb large shrimp, peeled and deveined; 2 tablespoons olive oil; 2 teaspoons chipotle chili powder; 1 teaspoon ground cumin; 1/2 teaspoon smoked paprika; 1/4 teaspoon garlic powder; 1/4 teaspoon onion powder; 1/2 teaspoon sea salt; 1/4 teaspoon black pepper; 2 tablespoons fresh lime juice; 1 tablespoon chopped fresh cilantro; 12 large butter lettuce leaves (or Bibb lettuce); 1 small avocado, sliced (optional, for serving); 1/4 cup finely diced red onion; 1/4 cup finely diced tomato; 1 jalapeño, seeded and finely diced (optional, for heat); Lime wedges for garnish

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 25, 2026 · Updated Jul 7, 2026

Mexican-inspired 20 mins glutenfreewhole30lowcarbdairyfreenutfreemaincourseeasyquickrecipesfamilyfriendlyappetizersnack

Enjoy these quick and easy Chipotle Lime Shrimp Lettuce Cups that are low-carb, gluten-free, and Whole30-approved. Perfect as a healthy family-friendly appetizer, snack, or main course with fresh Mexican-inspired flavors that make meal prep effortless.

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups

Prep 10 min

Cook 10 min

Total 20 min

Servings 4

Difficulty easy

Cuisine Mexican-inspired

Ingredients

Servings 4

1 lb large shrimp, peeled and deveined
2 tablespoons olive oil
2 teaspoons chipotle chili powder
1 teaspoon ground cumin
1/2 teaspoon smoked paprika
1/4 teaspoon garlic powder
1/4 teaspoon onion powder
1/2 teaspoon sea salt
1/4 teaspoon black pepper
2 tablespoons fresh lime juice
1 tablespoon chopped fresh cilantro
12 large butter lettuce leaves (or Bibb lettuce)
1 small avocado, sliced (optional, for serving)
1/4 cup finely diced red onion
1/4 cup finely diced tomato
1 jalapeño, seeded and finely diced (optional, for heat)
Lime wedges for garnish

FreeFlourish Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups ingredients

Instructions

In a medium bowl, combine olive oil, chipotle chili powder, cumin, smoked paprika, garlic powder, onion powder, salt, and black pepper.
Add the shrimp to the bowl and toss well to evenly coat. Let marinate for 5 minutes while preparing other ingredients.
Heat a large skillet over medium-high heat.
Add the shrimp to the skillet in a single layer and cook for 2-3 minutes on each side until opaque and cooked through.
Remove shrimp from heat and stir in fresh lime juice and chopped cilantro.
Lay out the lettuce leaves on a serving platter.
Divide the cooked shrimp evenly among the lettuce cups.
Top each cup with diced red onion, tomato, and jalapeño if using.
Add sliced avocado to each cup if desired.
Serve immediately with lime wedges on the side for squeezing over.
Enjoy these fresh, flavorful lettuce cups as a quick appetizer, snack, or light main course that is low-carb, gluten-free, and family-friendly.

FreeFlourish Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups for someone with celiac disease.

Texture Expectations

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups should keep the intended servings texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups ahead?: Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?: Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?: Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?: Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Ingredient Replacements

ño: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
Lime wedges for garnish: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups

Recipe Details

Ingredients

Instructions