Freeflourish

Quick & Easy

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 25, 2026 · Updated May 11, 2026
Mexican-inspired 20 mins glutenfreewhole30lowcarbdairyfreenutfreemaincourseeasyquickrecipesfamilyfriendlyappetizersnack

Enjoy these quick and easy Chipotle Lime Shrimp Lettuce Cups that are low-carb, gluten-free, and Whole30-approved. Perfect as a healthy family-friendly appetizer, snack, or main course with fresh Mexican-inspired flavors that make meal prep effortless.

Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups
Prep 10 min
Cook 10 min
Total 20 min
Servings 4
Difficulty easy
Cuisine Mexican-inspired

Recipe Details

Prep10 min
Cook10 min
Total20 min
Servings4
Difficultyeasy
CuisineMexican-inspired
Add To Favorites

Ingredients

Servings 4
  • 1 lb large shrimp, peeled and deveined
  • 2 tablespoons olive oil
  • 2 teaspoons chipotle chili powder
  • 1 teaspoon ground cumin
  • 1/2 teaspoon smoked paprika
  • 1/4 teaspoon garlic powder
  • 1/4 teaspoon onion powder
  • 1/2 teaspoon sea salt
  • 1/4 teaspoon black pepper
  • 2 tablespoons fresh lime juice
  • 1 tablespoon chopped fresh cilantro
  • 12 large butter lettuce leaves (or Bibb lettuce)
  • 1 small avocado, sliced (optional, for serving)
  • 1/4 cup finely diced red onion
  • 1/4 cup finely diced tomato
  • 1 jalapeño, seeded and finely diced (optional, for heat)
  • Lime wedges for garnish

Instructions

  1. In a medium bowl, combine olive oil, chipotle chili powder, cumin, smoked paprika, garlic powder, onion powder, salt, and black pepper.
  2. Add the shrimp to the bowl and toss well to evenly coat. Let marinate for 5 minutes while preparing other ingredients.
  3. Heat a large skillet over medium-high heat.
  4. Add the shrimp to the skillet in a single layer and cook for 2-3 minutes on each side until opaque and cooked through.
  5. Remove shrimp from heat and stir in fresh lime juice and chopped cilantro.
  6. Lay out the lettuce leaves on a serving platter.
  7. Divide the cooked shrimp evenly among the lettuce cups.
  8. Top each cup with diced red onion, tomato, and jalapeño if using.
  9. Add sliced avocado to each cup if desired.
  10. Serve immediately with lime wedges on the side for squeezing over.
  11. Enjoy these fresh, flavorful lettuce cups as a quick appetizer, snack, or light main course that is low-carb, gluten-free, and family-friendly.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

This easy recipe for Gluten-Free Whole30 Chipotle Lime Shrimp Lettuce Cups naturally meets gluten-free, dairy-free, nut-free, and Whole30 standards, perfect for diverse dietary needs. However, feel free to customize with these ingredient substitutions to suit personal preferences or dietary restrictions:

  • Shrimp: Swap for firm tofu cubes or sautéed mushrooms for a vegetarian or vegan protein alternative.
  • Olive Oil: Use avocado oil or coconut oil to keep the recipe Whole30-compliant and add healthy fats.
  • Chipotle Chili Powder: Replace with smoked paprika plus a dash of cayenne pepper to maintain smoky heat when unavailable.
  • Lettuce Cups: Butter or Bibb lettuce are ideal, but romaine or collard greens offer sturdier wraps for a different texture.
  • Avocado (optional): Add mashed avocado or Whole30-approved guacamole for creamy, dairy-free richness.
  • Spice Levels: Adjust heat by omitting jalapeño or adding more for extra kick; use Whole30-approved hot sauce if desired.

These variations keep the dish flavorful, family-friendly, and aligned with your health goals, whether for quick & easy lunches, dinners, or snack ideas.

Allergen Overlap Note

While these gluten-free recipes are thoughtfully crafted to accommodate multiple dietary needs—including dairy-free, nut-free, vegan, and Whole30 options—please remain mindful of potential allergen cross-contamination. Ingredients like nuts, dairy, or gluten-containing grains may be processed in shared facilities, posing risks especially for sensitive individuals.

To maintain a safe cooking environment for family-friendly and holiday & seasonal meals across our categories like Breakfast, Lunch, Dinner, Desserts, Snacks, and Soups & Salads, please consider the following precautions:

  • Check ingredient labels carefully for gluten-free certification and cross-contact warnings.
  • Use separate utensils, cutting boards, and cookware dedicated to gluten-free meal preparation.
  • Thoroughly clean kitchen surfaces before cooking gluten-free dishes.
  • Confirm that all ingredients meet specific allergen-free requirements when cooking for individuals with multiple allergies.
  • Opt for certified gluten-free and allergen-free spices, baking ingredients, and processed foods when available.

These steps help ensure safe and enjoyable dining for everyone, whether you’re making quick & easy dinners, holiday classics, or wholesome gluten-free baking treats.

Texture Expectations

Gluten-free dishes like our Whole30 Chipotle Lime Shrimp Lettuce Cups showcase a delightful range of textures that enhance their appeal. Expect a satisfying contrast between tender shrimp and crisp, fresh greens, perfect for a quick snack or main course.

  • Shrimp: Cooked just right, shrimp are firm yet tender with a slight snap, avoiding any rubbery chewiness.
  • Marinade & Spices: The olive oil-based chipotle seasoning coats the shrimp with a lightly oily, flavorful finish that keeps them moist without heaviness.
  • Lettuce Cups: Crisp butter or Bibb lettuce leaves provide a refreshing and sturdy base, creating a pleasant contrast with the shrimp’s texture.
  • Toppings: Finely diced red onions and tomatoes add juicy crunch, while jalapeño pieces contribute crispness with balanced heat. Optional avocado slices introduce creamy softness, rounding out the texture profile.

This natural gluten-free, dairy-free recipe relies on fresh whole foods to deliver clean, crisp bites rather than dense or creamy elements found in traditional dishes. To preserve these textures, serve immediately after assembly. This makes the dish particularly enjoyable as a low-carb, family-friendly appetizer, snack, or light dinner.

Dining With Non Gf Family Note

Preparing gluten-free meals like these Chipotle Lime Shrimp Lettuce Cups in a household with non-gluten-free family members requires careful planning to ensure safety and inclusivity. Follow these tips to enjoy stress-free dining together:

  • Designate separate cooking zones and utensils: Use exclusive cutting boards, cookware, and toaster slots when preparing gluten-free foods to prevent contamination.
  • Maintain cleanliness: Thoroughly clean counters, utensils, and hands before starting gluten-free meal prep and after handling gluten-containing items.
  • Plan flexible, family-friendly meals: Choose dishes from categories like Quick & Easy, Soups & Salads, and Gluten-Free Baking that adapt well for everyone’s needs.
  • Label and store ingredients properly: Keep gluten-free items in clearly marked containers to avoid mixing.
  • Communicate meal details: Inform family members about gluten-containing ingredients especially for snacks, desserts, and shared dishes.
  • Use separate serving plates and condiments: Prevent cross-contact by avoiding shared dipping sauces or double-dipping practices.
  • Emphasize simplicity and convenience: Prioritize One-Pot or quick recipes to streamline preparation and reduce cross-contamination risks.

By following these guidelines, you can safely enjoy gluten-free, dairy-free, nut-free, and Whole30-friendly recipes with your whole family, from breakfasts to holiday classics.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.