Freeflourish

Snacks

Gluten-Free Moroccan Spiced Carrot and Chickpea Soup

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished Apr 11, 2026 · Updated May 11, 2026
Moroccan 30 mins glutenfreevegandairyfreehighproteinwhole30onepotmealprephealthyfamilyfriendlyquickrecipes30minutesorlesscomfortfoodmaincoursedairyfreeoptionssidedish

This nourishing gluten-free soup delivers the vibrant flavors of Morocco through aromatic spices paired with hearty carrots and protein-packed chickpeas. An easy, one-pot vegan and dairy-free recipe that is high in protein, Whole30-compliant, and ideal for quick nutritious dinners, meal prepping, or wholesome family meals.

Gluten-Free Moroccan Spiced Carrot and Chickpea Soup
Prep 10 min
Cook 20 min
Total 30 min
Servings 6
Difficulty easy
Cuisine Moroccan

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings6
Difficultyeasy
CuisineMoroccan
Add To Favorites

Ingredients

Servings 6
  • 2 tablespoons olive oil
  • 1 medium onion, finely chopped
  • 3 garlic cloves, minced
  • 1 tablespoon fresh ginger, grated
  • 1 teaspoon ground cumin
  • 1 teaspoon ground coriander
  • 1 teaspoon smoked paprika
  • 1/2 teaspoon ground cinnamon
  • 1/4 teaspoon ground turmeric
  • 1/4 teaspoon cayenne pepper (optional, adjust for heat)
  • 4 medium carrots, peeled and diced
  • 1 (15 oz) can chickpeas, drained and rinsed
  • 4 cups vegetable broth (gluten-free, low sodium)
  • 1 (14 oz) can diced tomatoes, with juices
  • Salt and black pepper, to taste
  • Juice of 1 lemon
  • 2 tablespoons chopped fresh cilantro (plus extra for garnish)
  • 2 tablespoons chopped fresh parsley (optional)

Instructions

  1. In a large pot or Dutch oven, heat the olive oil over medium heat.
  2. Add the chopped onion and sauté for 5 minutes, until softened and translucent.
  3. Stir in the minced garlic and grated ginger and cook for another 1 minute until fragrant.
  4. Add the cumin, coriander, smoked paprika, cinnamon, turmeric, and cayenne pepper if using. Stir well and cook spices for about 1 minute to release their aromas.
  5. Add the diced carrots and drained chickpeas to the pot. Stir to coat them evenly with the spices.
  6. Pour in the gluten-free vegetable broth and canned diced tomatoes with their juices. Stir to combine all ingredients.
  7. Bring the soup to a boil, then reduce heat and simmer uncovered for 15-20 minutes, until the carrots are tender.
  8. Using an immersion blender, partially blend the soup directly in the pot to achieve a creamy but slightly chunky texture. Alternatively, blend half the soup in a blender and return it to the pot.
  9. Season with salt and black pepper to taste. Stir in the fresh lemon juice, chopped cilantro, and parsley if using.
  10. Simmer for an additional 2 minutes to meld flavors.
  11. Serve hot, garnished with extra fresh cilantro if desired. Enjoy as a comforting main course or starter.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

This Gluten-Free Moroccan Spiced Carrot and Chickpea Soup naturally fits several dietary lifestyles, and here are ingredient swaps and tips to make it even more adaptable:

  • Gluten-Free: The recipe is naturally gluten-free when using gluten-free vegetable broth. Always confirm all canned and packaged ingredients are labeled gluten-free.
  • Dairy-Free: This recipe contains no dairy ingredients, perfect for those with dairy restrictions.
  • Vegan & Vegetarian: Entirely plant-based, containing no animal products.
  • Low-Carb / Whole30 / Paleo: Chickpeas add carbohydrates; for a lower-carb or strict Whole30/Paleo version, substitute chickpeas with diced zucchini, cauliflower florets, or green beans to maintain texture and volume.
  • Nutfree: Contains no nuts, suitable for nut-free diets.
  • Herb Alternatives: If fresh cilantro or parsley aren't available, use dried herbs or fresh mint for a different but complementary flavor profile.
  • Spice Adjustments: Reduce or omit cayenne pepper for a milder, kid-friendly version, or swap smoked paprika for sweet paprika to soften the spice level.

These substitutions help tailor the soup to your family's dietary needs while preserving the comforting Moroccan essence and making it a versatile dish for any season or occasion.

Allergen Overlap Note

While our gluten-free recipes are carefully crafted to avoid gluten-containing ingredients, it's important to remain vigilant about potential allergen cross-contamination, especially in kitchens that also process wheat, barley, rye, or shared equipment. If you are highly sensitive to gluten or other allergens such as nuts or dairy (common in some recipes tagged dairyfree or nutfree), ensure that all ingredients are certified gluten-free and free from cross-contact.

For those adhering to multiple dietary restrictions—such as vegan, paleo, or whole30—verify that packaged products (like broth or canned goods) meet your specific needs. Clean preparation surfaces, utensils, and cookware thoroughly before use to maintain safety, particularly when preparing family-friendly, budget-friendly, or meal-prep recipes where batches might be made in bulk.

We recommend always reading labels and, when in doubt, consulting product manufacturers. Prioritizing these safe cooking practices helps maintain the wholesome, delicious quality of your gluten-free breakfasts, lunches, dinners, desserts, snacks, soups, salads, and baked goods.

Texture Expectations

Gluten-free recipes often showcase unique textures compared to traditional wheat-based dishes, and this Moroccan Spiced Carrot and Chickpea Soup is a wonderful example. Expect a richly comforting, moderately thick texture, largely due to the combination of pureed and whole ingredients.

In this recipe, the carrots and chickpeas cook to a tender yet hearty consistency. Partial blending creates a creamy base with delightful chunks that add body and satisfyingly varied mouthfeel. This balance provides both smoothness and texture without relying on gluten-containing thickeners.

If you prefer a fully smooth soup, blending all the ingredients will yield a velvety consistency reminiscent of traditional pureed soups, while blending less will keep more noticeable vegetable tender bites. The presence of chickpeas adds subtle graininess and protein-rich heft, lending a wholesome, filling texture suitable for a main course or starter.

As this recipe is gluten-free, vegan, dairy-free, and whole30-compliant, it also avoids common texture enhancers like cream or gluten-based thickeners. Instead, the natural starches from carrots and legumes create body and mouthfeel, resulting in a nourishing soup with a pleasant, slightly rustic texture.

For freezing and reheating, note that the texture may become a bit thicker; simply add a splash of vegetable broth or water when warming to restore desired consistency. Overall, this soup exemplifies the delicious and comforting textures you can enjoy in gluten-free, plant-based meals.

Dining With Non Gf Family Note

Preparing gluten-free meals alongside family members who consume gluten can be seamless and safe by following some simple practices to avoid cross-contamination and promote harmony at the table. Whether you’re making Breakfast, Lunch, Dinner, Desserts, or Snacks, these tips support coexistence while catering to all preferences.

  • Designate Gluten-Free Areas and Utensils: Use separate cutting boards, knives, toasters, and cookware for gluten-free food preparation to prevent trace gluten exposure.
  • Store Gluten-Free Ingredients Separately: Keep gluten-free flours, grains, and packaged items in clearly labeled, sealed containers away from gluten-containing products.
  • Prepare Meals Sequentially: Cook gluten-free dishes first or at different times from gluten-containing meals to reduce risk of contamination.
  • Clean Surfaces Thoroughly: Wipe counters, utensils, and appliances with hot, soapy water before starting gluten-free cooking and between meal preparations.
  • Use Dedicated Oil and Spreads: Avoid sharing butter, oils, or spreads from the same dish if a gluten item has touched them; use clean spoons for serving.
  • Communicate Clearly: Talk openly about gluten-free needs with non-GF family members, especially when sharing meals or eating out, to help everyone stay safe and comfortable.
  • Label Foods at Meals: When serving family-style dishes or buffets, clearly identify gluten-free options to prevent confusion.
  • Focus on Naturally Gluten-Free Recipes: Embrace foods from categories like Soups & Salads, Gluten-Free Baking, Family-Friendly, and Holiday & Seasonal that everyone can enjoy without compromise.

Implementing these strategies allows families to enjoy a variety of dishes—whether dairyfree, nutfree, vegan, lowcarb, or highprotein—while maintaining a safe, inclusive environment for all dietary needs and preferences.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.