How do I keep this recipe gluten-free?

Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.

Can I adjust the main ingredients?

Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.

How do I serve it with mixed-diet family?

Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Back to Recipes

Family-Friendly

Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers

Name: Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers
Prep time: 15 min
Cook time: 40 min
Total time: 55 min
Yield: 6 servings
Cuisine: Middle Eastern-inspired
Ingredients: 2 medium eggplants (about 1 pound), whole; 3/4 cup raw walnuts, toasted; 2 garlic cloves, minced; 1/4 cup fresh lemon juice; 1/4 cup extra virgin olive oil, plus more for drizzle; 1 teaspoon ground cumin; 1/2 teaspoon smoked paprika; 1/2 teaspoon sea salt, or to taste; Freshly ground black pepper, to taste; 1 tablespoon chopped fresh parsley (optional, for garnish); 1/2 cup pumpkin seeds (pepitas); 1/2 cup sunflower seeds, shelled; 1/4 cup sesame seeds; 2 tablespoons flaxseed meal; 1/4 teaspoon sea salt; 2 tablespoons olive oil; 3 tablespoons water

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 11, 2026 · Updated Jul 7, 2026

Middle Eastern-inspired 55 mins glutenfreelowcarbdairyfreevegetarianappetizerfamilyfriendlyhealthyeasymealprepquickrecipessnack

Enjoy a flavorful Middle Eastern-inspired gluten-free and low-carb appetizer featuring a creamy eggplant and walnut dip served with crunchy toasted seed crackers. Ideal for family-friendly gatherings, meal prep, healthy snacking, and quick & easy entertaining.

Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers

Prep 15 min

Cook 40 min

Total 55 min

Servings 6

Difficulty easy

Cuisine Middle Eastern-inspired

Ingredients

Servings 6

2 medium eggplants (about 1 pound), whole
3/4 cup raw walnuts, toasted
2 garlic cloves, minced
1/4 cup fresh lemon juice
1/4 cup extra virgin olive oil, plus more for drizzle
1 teaspoon ground cumin
1/2 teaspoon smoked paprika
1/2 teaspoon sea salt, or to taste
Freshly ground black pepper, to taste
1 tablespoon chopped fresh parsley (optional, for garnish)
1/2 cup pumpkin seeds (pepitas)
1/2 cup sunflower seeds, shelled
1/4 cup sesame seeds
2 tablespoons flaxseed meal
1/4 teaspoon sea salt
2 tablespoons olive oil
3 tablespoons water

FreeFlourish Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers ingredients

Instructions

Preheat your oven to 400 degrees F. Pierce the whole eggplants several times with a fork. Place them on a baking sheet lined with parchment paper and roast for 35-40 minutes, until the skin is charred and the flesh is soft. Remove from oven and let cool.
Meanwhile, prepare the toasted seed crackers: In a bowl, combine pumpkin seeds, sunflower seeds, sesame seeds, flaxseed meal, and salt. Stir in olive oil and water until the mixture forms a moist dough.
Line a baking sheet with parchment paper. Spread the seed dough evenly, pressing it down with a spatula to form a thin, even layer about 1/8 inch thick. Score the dough lightly into cracker-sized rectangles with a knife.
Bake the seed crackers alongside the eggplants for about 15-20 minutes, until golden and crisp. Remove from oven and allow to cool completely before breaking along the scored lines.
Once the eggplants have cooled, cut them in half and scoop out the flesh into a strainer or colander. Let it drain for 10 minutes to remove excess moisture.
Transfer the eggplant flesh to a food processor. Add toasted walnuts, minced garlic, lemon juice, olive oil, cumin, smoked paprika, salt, and pepper. Process until smooth and creamy, scraping down the sides as needed. Taste and adjust seasoning if desired.
Transfer the dip to a serving bowl. Drizzle with a little olive oil and sprinkle with chopped parsley, if using.
Serve the eggplant and walnut dip alongside the toasted seed crackers for a healthy gluten-free appetizer or snack.
Store any leftovers in an airtight container in the refrigerator for up to 4 days. The dip can be served cold or at room temperature.

FreeFlourish Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers finished dish

Tips

Allergen Overlap Note

Check every packaged ingredient for certified gluten-free status, especially spices, broths, sauces, seed products, and baking staples. Use clean prep surfaces and dedicated utensils when preparing Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers for someone with celiac disease.

Texture Expectations

Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers should keep the intended servings texture when cooked and plated carefully.

Dining With Non-GF Family Note

Prepare and serve on a dedicated gluten-free surface first, then keep any shared side dishes separate with dedicated serving utensils.

Frequently Asked Questions

Can I make Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers ahead?: Yes. Prepare components early, then store and reheat according to the storage guidance so the texture stays close to fresh.
How do I keep this recipe gluten-free?: Use certified gluten-free packaged ingredients and avoid shared utensils, boards, pans, or toppings that touched gluten-containing foods.
Can I adjust the main ingredients?: Yes. Swap ingredients with similar moisture, protein, or cooking behavior to keep timing and texture close to the original.
How do I serve it with mixed-diet family?: Serve the gluten-free recipe first and keep any gluten-containing toppings and sides separate.

Ingredient Replacements

Freshly ground black pepper: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
main vegetable: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
protein: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
seasoning: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.
cooking fat: Use a certified gluten-free equivalent and choose a similar ingredient with matching moisture, texture, or cooking time. Check labels for shared-facility warnings when cooking for celiac disease or multiple allergies.

Storage and Reheating

Cool completely before covering. Refrigerate leftovers for up to 4 days, or freeze for later use. Reheat slowly to keep texture closer to fresh.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Gluten-Free Low-Carb Eggplant and Walnut Dip with Toasted Seed Crackers

Recipe Details

Ingredients

Instructions