Freeflourish

Lunch

Gluten-Free Low-Carb Chicken and Zucchini Noodle Stir-Fry with Ginger and Scallions

By Freeflourish Test KitchenReviewed by Freeflourish Editorial TeamPublished May 10, 2026 · Updated May 11, 2026
Asian-inspired 25 mins glutenfreelowcarbmaincourseeasyquickrecipesfamilyfriendlyhealthy

This gluten-free, low-carb chicken and zucchini noodle stir-fry is a quick, healthy, Asian-inspired meal packed with fresh ginger, scallions, and crisp vegetables. Ideal for family-friendly lunches or dinners.

Gluten-Free Low-Carb Chicken and Zucchini Noodle Stir-Fry with Ginger and Scallions
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine Asian-inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineAsian-inspired
Add To Favorites

Ingredients

Servings 4
  • 2 medium zucchinis, spiralized into noodles
  • 1 lb (450g) boneless, skinless chicken breasts, thinly sliced
  • 2 tbsp coconut aminos (gluten-free soy sauce alternative)
  • 1 tbsp avocado oil or other neutral oil
  • 1 tbsp fresh ginger, finely grated
  • 3 scallions, thinly sliced (white and green parts separated)
  • 2 garlic cloves, minced
  • 1 small red bell pepper, thinly sliced
  • 1 medium carrot, julienned or thinly sliced
  • 1/2 tsp crushed red pepper flakes (optional, for mild heat)
  • Salt and freshly ground black pepper, to taste
  • 1 tbsp toasted sesame seeds (optional, for garnish)
  • Lime wedges, for serving (optional)

Instructions

  1. Prepare the zucchini noodles by spiralizing the zucchinis and set aside. Pat them dry with paper towels to remove excess moisture.
  2. In a medium bowl, combine the sliced chicken with 1 tablespoon of coconut aminos and a pinch of salt and pepper. Let marinate for 5 minutes while prepping vegetables.
  3. Heat avocado oil in a large non-stick skillet or wok over medium-high heat.
  4. Add the grated ginger, minced garlic, and the white parts of the scallions. Sauté for about 1 minute until fragrant.
  5. Add the marinated chicken to the pan in a single layer. Cook undisturbed for 2-3 minutes, then stir occasionally until the chicken is cooked through and lightly browned, about 5-6 minutes total.
  6. Add the red bell pepper and carrot slices to the skillet and stir-fry for 2-3 minutes until slightly tender but still crisp.
  7. Add the zucchini noodles to the skillet, stirring gently to combine with the chicken and veggies. Pour in the remaining 1 tablespoon of coconut aminos and stir well.
  8. Cook for an additional 2-3 minutes until the zucchini noodles are tender but still firm. Avoid overcooking to prevent sogginess.
  9. Season with crushed red pepper flakes (if using), and adjust salt and pepper to taste.
  10. Remove from heat, garnish with the green parts of the scallions and toasted sesame seeds if desired.
  11. Serve immediately with lime wedges on the side for a fresh citrus kick.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize this gluten-free, low-carb chicken and zucchini noodle stir-fry to suit various dietary needs or preferences with these ingredient substitutions:

  • Chicken: For vegetarian or vegan diets, substitute chicken with firm tofu or tempeh, pressing and marinating similarly for best flavor.
  • Coconut Aminos: Naturally gluten-free and soy-free, coconut aminos can be replaced with gluten-free tamari or liquid aminos, adjusting salt levels as needed.
  • Avocado Oil: Swap with other neutral oils like grapeseed or light olive oil if unavailable; for paleo or whole30 compliance, use oils approved like avocado or coconut oil.
  • Toasted Sesame Seeds: Omit or substitute with toasted sunflower seeds if nut or seed allergies are a concern.
  • Vegetables: Replace red bell pepper and carrot with other crunchy veggies such as snap peas or broccoli for variety or seasonal availability.

These substitutions maintain the recipe’s balanced flavor and texture while fitting lifestyles such as vegan, vegetarian, dairy-free, nut-free, paleo, and whole30. Adjust seasoning and cooking times as necessary.

Allergen Overlap Note

While our recipes are carefully created to be gluten-free and often accommodate other dietary preferences such as dairy-free, nut-free, vegan, and paleo, it is important to consider potential allergen cross-contamination risks in your kitchen. Shared utensils, cutting boards, oils, and cooking surfaces can inadvertently introduce gluten or other allergens into naturally gluten-free dishes.

To ensure safety when preparing gluten-free meals across categories including Breakfast, Lunch, Dinner, Desserts, Snacks, Soups & Salads, and Gluten-Free Baking, we recommend these best practices:

  • Use dedicated and thoroughly cleaned equipment and cookware exclusively for gluten-free preparation.
  • Store gluten-free ingredients separately from gluten-containing foods to prevent cross-contact.
  • Always check packaged ingredients, such as sauces and seasoning blends, for hidden gluten and allergens.
  • Assess your household environment; if gluten is common, take extra precautions to avoid contamination.
  • When substituting ingredients, verify that replacements adhere to gluten-free and other allergen criteria as tagged (e.g., dairyfree, nutfree).

By following these steps, you can confidently enjoy our diverse gluten-free recipes—from quick and easy family-friendly mains to indulgent desserts and holiday classics—while safeguarding everyone’s dietary health.

Texture Expectations

Gluten-free dishes, especially those featuring fresh vegetables and lean proteins like this low-carb chicken and zucchini noodle stir-fry, offer a distinctive texture experience compared to traditional wheat-based meals. Expect a harmonious blend of tender and crisp textures that enhance every bite.

Chicken: Thinly sliced chicken breast cooks quickly and remains tender with a pleasant, slightly firm bite when not overcooked. Marinating briefly in coconut aminos locks in moisture, preventing dryness often seen in gluten-free dishes lacking gluten’s binding properties.

Zucchini Noodles: Unlike traditional pasta, zucchini noodles have a light, mildly crunchy texture when properly cooked. Cooking them just until tender yet firm (2-3 minutes) maintains an appealing bite and prevents excess moisture that could cause sogginess. Drying the noodles before cooking is essential for optimal texture.

Vegetables: The red bell pepper and carrot provide crispness that contrasts pleasantly with the tender chicken and zucchini. Stir-frying vegetables just until lightly tender ensures freshness and bite, elevating the overall mouthfeel.

Overall: Expect a fresh, vibrant texture profile that feels lighter than many gluten-based stir-fries with noodles. This recipe expertly balances tender protein with crisp, lightly cooked vegetables, making it an ideal family-friendly meal for weekday lunches or dinners.

Dining With Non Gf Family Note

Preparing gluten-free meals alongside family members who eat gluten can be seamless when simple practices are followed to prevent cross-contamination and keep everyone safe and satisfied. Here are effective tips for maintaining a clean, inclusive kitchen environment:

  • Designate Separate Cooking Areas and Utensils: Use distinct cutting boards, knives, and utensils for gluten-free ingredients. If space is limited, thoroughly clean surfaces and tools before reuse.
  • Store Gluten-Free Ingredients Separately: Keep gluten-free flours, grains, and snacks clearly labeled and apart from gluten-containing foods to avoid accidental mixing.
  • Use Clean Hands and Change Gloves: Wash hands thoroughly before handling gluten-free food and consider wearing fresh gloves to prevent contamination from shared surfaces.
  • Cook Gluten-Free Foods First: Prepare and cook gluten-free recipes before gluten-containing dishes whenever possible to minimize airborne flour or crumbs.
  • Be Mindful with Shared Appliances: For items like toasters or ovens, consider a dedicated gluten-free toaster or bake gluten-free items separately on clean trays or parchment paper.
  • Communicate Openly: Explain the importance of preventing cross-contamination to all family members to encourage mindful habits.
  • Clean As You Go: Regularly wipe down counters, handles, and stove knobs during meal prep to reduce gluten residue.
  • Serving Tips: Use separate serving dishes, utensils, and plates for gluten-free meals and label them clearly during family or holiday gatherings.

Following these strategies makes sharing your favorite Freeflourish recipes—whether Breakfast, Lunch, Dinner, or Desserts—safer and more enjoyable for everyone, regardless of dietary needs.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Freeflourish.